(data stored in ACNUC7421 zone)

EMBL: CP001111.PE276

CP001111.PE276       Location/Qualifiers
FT   CDS             324115..325002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0276"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: ppg:PputGB1_1427 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49981"
FT                   /db_xref="GOA:B4STD8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4STD8"
FT                   /protein_id="ACF49981.1"
FT                   /translation="MNLKQLEFAVALAEEGNFTRAAERCHVVQSALSHQIANLEQELGT
FT                   PLFERLPRQVRATAAGEVLLVHARQVLASLRHLRADVAAVSGEVRGLLAIGQISSLTDI
FT                   DVVAMLAAFQQAHPQVEFQLRVDKSEDLIAQVQSRELDVALVGLAPSAGLDGVCHQMLQ
FT                   EEDLVAVLAPSHRLAGHTRLPLAALQDEALVDFPRGTGARRQTDDAFAAAGLPHTVRFE
FT                   VNLMELIERFVRHGLAVGIVPALIADGFQGVVQIPLQPTPTRRVHLVWQRLPTPAARAF
FT                   VAAVLSRAGAGSGP"
     MNLKQLEFAV ALAEEGNFTR AAERCHVVQS ALSHQIANLE QELGTPLFER LPRQVRATAA        60
     GEVLLVHARQ VLASLRHLRA DVAAVSGEVR GLLAIGQISS LTDIDVVAML AAFQQAHPQV       120
     EFQLRVDKSE DLIAQVQSRE LDVALVGLAP SAGLDGVCHQ MLQEEDLVAV LAPSHRLAGH       180
     TRLPLAALQD EALVDFPRGT GARRQTDDAF AAAGLPHTVR FEVNLMELIE RFVRHGLAVG       240
     IVPALIADGF QGVVQIPLQP TPTRRVHLVW QRLPTPAARA FVAAVLSRAG AGSGP            295
//

If you have problems or comments...

PBIL Back to PBIL home page