(data stored in ACNUC7421 zone)

EMBL: CP001111.PE277

CP001111.PE277       Location/Qualifiers
FT   CDS             complement(324971..325438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0277"
FT                   /product="protein of unknown function DUF1456"
FT                   /note="PFAM: protein of unknown function DUF1456; KEGG:
FT                   xcb:XC_0287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49982"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:B4STD9"
FT                   /protein_id="ACF49982.1"
FT                   /translation="MINNDVLRSVRYSLDLGDHHVVTLCQLADPAFAVDTEQVKAWLRR
FT                   DDEAGFEAMNDSALAHFLDGLIVHLRGRDESQPQRAVETRIDNNLVLKKLRVAFQLRDV
FT                   DLMEIFASAGFNVSKSEIGALFRQPGHTNYRRCLDQMLRNFLKGLSLRLRG"
     MINNDVLRSV RYSLDLGDHH VVTLCQLADP AFAVDTEQVK AWLRRDDEAG FEAMNDSALA        60
     HFLDGLIVHL RGRDESQPQR AVETRIDNNL VLKKLRVAFQ LRDVDLMEIF ASAGFNVSKS       120
     EIGALFRQPG HTNYRRCLDQ MLRNFLKGLS LRLRG                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page