(data stored in ACNUC7421 zone)

EMBL: CP001111.PE278

CP001111.PE278       Location/Qualifiers
FT   CDS             325601..326353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0278"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: xcv:XCV4032 putative oxidoreductase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49983"
FT                   /db_xref="GOA:B4STE0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE0"
FT                   /protein_id="ACF49983.1"
FT                   /translation="MTRTVLITGATSGFGAAAVHRFAQAGWKVIATGRRGERLQPLVER
FT                   YGKDVVHAAVFDIRDPVAMEAALLALPPAFGEIDLLVNNAGLAQGTAPAQSAKLSDWTT
FT                   MIDTNITALVTLTHRLLPQLVERKGAIINISSVAGVYPYPGGNAYGGTKAFVSQFSLGL
FT                   RSDLHGTGVRVTTIEPGMAETEFTVVRTHGDQAASDKLYTGANPMTAEDIAEQIFWVAT
FT                   LPPHLNINRLELMPVSQSFAGFQVAREG"
     MTRTVLITGA TSGFGAAAVH RFAQAGWKVI ATGRRGERLQ PLVERYGKDV VHAAVFDIRD        60
     PVAMEAALLA LPPAFGEIDL LVNNAGLAQG TAPAQSAKLS DWTTMIDTNI TALVTLTHRL       120
     LPQLVERKGA IINISSVAGV YPYPGGNAYG GTKAFVSQFS LGLRSDLHGT GVRVTTIEPG       180
     MAETEFTVVR THGDQAASDK LYTGANPMTA EDIAEQIFWV ATLPPHLNIN RLELMPVSQS       240
     FAGFQVAREG                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page