(data stored in ACNUC7421 zone)

EMBL: CP001111.PE279

CP001111.PE279       Location/Qualifiers
FT   CDS             complement(326515..327426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0279"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: xcv:XCV4030
FT                   putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49984"
FT                   /db_xref="GOA:B4STE1"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE1"
FT                   /protein_id="ACF49984.1"
FT                   /translation="MAARRGKNQARRNSSSQGTPGWVWLVAGVAIAAVVFLAAPNLFKG
FT                   EGDGFLRAGPQPNPNAQPAPVADADSDVGTQPAAQPATPKPAEAEKPAATQYDFYTLLP
FT                   GKEVEMSDAELAASARAEDQRRAKAEAQRAQAALEGKPVPPATATATAPAPTATASVAS
FT                   TAPVTATSRPLPAPLSERPAAATPAANTTAASSNTAATTAAPRAEAAPAATSTAATAAP
FT                   AAADNARYILQAGAFGASGDAEATKAKLAMMGLAARVESAQINGKTVYRVRMGPYGSAG
FT                   ELSEAKQKLDGTGLQAMAIKAQ"
     MAARRGKNQA RRNSSSQGTP GWVWLVAGVA IAAVVFLAAP NLFKGEGDGF LRAGPQPNPN        60
     AQPAPVADAD SDVGTQPAAQ PATPKPAEAE KPAATQYDFY TLLPGKEVEM SDAELAASAR       120
     AEDQRRAKAE AQRAQAALEG KPVPPATATA TAPAPTATAS VASTAPVTAT SRPLPAPLSE       180
     RPAAATPAAN TTAASSNTAA TTAAPRAEAA PAATSTAATA APAAADNARY ILQAGAFGAS       240
     GDAEATKAKL AMMGLAARVE SAQINGKTVY RVRMGPYGSA GELSEAKQKL DGTGLQAMAI       300
     KAQ                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page