(data stored in ACNUC7421 zone)

EMBL: CP001111.PE283

CP001111.PE283       Location/Qualifiers
FT   CDS             complement(331174..331800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0283"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: bcm:Bcenmc03_4702 two component
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49988"
FT                   /db_xref="GOA:B4STE5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE5"
FT                   /protein_id="ACF49988.1"
FT                   /translation="MHPRIIIADDHPVVLHGIRVVLQTHLMDVVGSACDGAELLQLVDN
FT                   NDCDAVLTDLSMPGAGPDGPELIDALRARHPGLPVVVLTGARHPGLLDGLLREGISGLV
FT                   DKCADFTELPQALSAALAGQVFVSQQLRHHLQARDLLFPREPAPLSAREQEVLDLLAAG
FT                   LSVNAVAERCGRSPKTISRQKAEAKRKLGLQNNQELFDYLQTRRD"
     MHPRIIIADD HPVVLHGIRV VLQTHLMDVV GSACDGAELL QLVDNNDCDA VLTDLSMPGA        60
     GPDGPELIDA LRARHPGLPV VVLTGARHPG LLDGLLREGI SGLVDKCADF TELPQALSAA       120
     LAGQVFVSQQ LRHHLQARDL LFPREPAPLS AREQEVLDLL AAGLSVNAVA ERCGRSPKTI       180
     SRQKAEAKRK LGLQNNQELF DYLQTRRD                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page