(data stored in ACNUC7421 zone)

EMBL: CP001111.PE284

CP001111.PE284       Location/Qualifiers
FT   CDS             332029..333291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0284"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: xcb:XC_3943 bifunctional
FT                   phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate synthase; TIGRFAM:
FT                   phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49989"
FT                   /db_xref="GOA:B4STE6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE6"
FT                   /protein_id="ACF49989.1"
FT                   /translation="MADSPNASPAPARALEGQKLLLCVGGGIAAYKALELVRRLRDAGA
FT                   QVQVAMTAGAQQFVTPLSFQALSGQPTRTTLWDSAAEQAMGHIELARWADRIVVAPGTA
FT                   DLLARLAQGHADDLVSTLCLASTAPLTICPAMNHRMWLHPATQANIALLRQRGAQVIGP
FT                   VDGPLAEGESGPGRLAEPGDIVAALAANGSAEAPAAAPETRALQGLRLLISAGPTYEDI
FT                   DPVRYVGNRSSGKMGFALAAAAAALGAQVVLVSGPVQLPTPQGVQRIDVRSAAQMRDAV
FT                   LKSLPADIYIGAAAVSDYTPRQVAPQKLKKTADSQSLVIELVRTPDILAEVAAQTQSLK
FT                   LVVGFAAETHDVEKYARGKLVDKRLDLVIANQVGISGGGFESDNNAATAFWQDGEQVFP
FT                   ATSKRELAEQLLALIARRLQA"
     MADSPNASPA PARALEGQKL LLCVGGGIAA YKALELVRRL RDAGAQVQVA MTAGAQQFVT        60
     PLSFQALSGQ PTRTTLWDSA AEQAMGHIEL ARWADRIVVA PGTADLLARL AQGHADDLVS       120
     TLCLASTAPL TICPAMNHRM WLHPATQANI ALLRQRGAQV IGPVDGPLAE GESGPGRLAE       180
     PGDIVAALAA NGSAEAPAAA PETRALQGLR LLISAGPTYE DIDPVRYVGN RSSGKMGFAL       240
     AAAAAALGAQ VVLVSGPVQL PTPQGVQRID VRSAAQMRDA VLKSLPADIY IGAAAVSDYT       300
     PRQVAPQKLK KTADSQSLVI ELVRTPDILA EVAAQTQSLK LVVGFAAETH DVEKYARGKL       360
     VDKRLDLVIA NQVGISGGGF ESDNNAATAF WQDGEQVFPA TSKRELAEQL LALIARRLQA       420
//

If you have problems or comments...

PBIL Back to PBIL home page