(data stored in ACNUC7421 zone)

EMBL: CP001111.PE286

CP001111.PE286       Location/Qualifiers
FT   CDS             333774..336122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0286"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: xcv:XCV4025 phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49991"
FT                   /db_xref="GOA:B4STE8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE8"
FT                   /protein_id="ACF49991.1"
FT                   /translation="MSGIGEGQRGRSLGRSAPLLGVLLILLAGWFGWSAVQQWRQEANG
FT                   QALEEARDQAVQGLQDAAAGQLKQLQQQLKNERVQQALQAGDAAAAALAVRESWTGVEQ
FT                   AEVLSADLASAYADPATFGYARLALLEAALAEAKPSLRVVRDGGGNRLGLAAPVQLGSL
FT                   GPAVLYVRQPLLRLTAPLDQVSAPATGFLGLRQGMHDLVTQGDASLAESAEALARPIPG
FT                   TPLRLVAAVPNVESGPLGLGALASAIVALLLAFIAVLLVIGRGRLPKTLPLPRRAAAAD
FT                   ADHGPTLSESLQQAPPAVAAVTSSGDATPPSPPPVPAEALAAGIFRAYDIRGVVGSELT
FT                   PKTAALIGQAIGTVALEQGLREVVIGRDGRLSGQELAAGLAEGLRRAGCAVIDIGLAPT
FT                   PLVYYAAFHLRTGTCVAVTGSHNPPEYNGFKVVIGGETLSGDAITDLYQRIVEGRLVQA
FT                   AEPGDYQQRDVAADYIQRIADDVQLDRPLKVVADAGNGVAGALAPQLLEAIGAEVIPLY
FT                   CDVDGTFPNHHPDPSEPANLEDLVQTVKRFGADLGVAFDGDGDRLGVVTAEGKIIYADR
FT                   LLMLFAADVLMRNPGAMVIYDVKCTGKLSDHVLRNGGSPLMWKTGHSLMKAKMRETDAE
FT                   LAGEMSGHFFFKERWFGFDDGLYAAARLLEILAQREETPDEVLAELPEMVATPELKVPV
FT                   AEGTPHALVAMLVAAAQSPDNPYVGGRLSTIDGLRVDFPDGWGLVRASNTTPVLVLRFE
FT                   GNDEAALERIQALFRSQLQPVLGDTPLGF"
     MSGIGEGQRG RSLGRSAPLL GVLLILLAGW FGWSAVQQWR QEANGQALEE ARDQAVQGLQ        60
     DAAAGQLKQL QQQLKNERVQ QALQAGDAAA AALAVRESWT GVEQAEVLSA DLASAYADPA       120
     TFGYARLALL EAALAEAKPS LRVVRDGGGN RLGLAAPVQL GSLGPAVLYV RQPLLRLTAP       180
     LDQVSAPATG FLGLRQGMHD LVTQGDASLA ESAEALARPI PGTPLRLVAA VPNVESGPLG       240
     LGALASAIVA LLLAFIAVLL VIGRGRLPKT LPLPRRAAAA DADHGPTLSE SLQQAPPAVA       300
     AVTSSGDATP PSPPPVPAEA LAAGIFRAYD IRGVVGSELT PKTAALIGQA IGTVALEQGL       360
     REVVIGRDGR LSGQELAAGL AEGLRRAGCA VIDIGLAPTP LVYYAAFHLR TGTCVAVTGS       420
     HNPPEYNGFK VVIGGETLSG DAITDLYQRI VEGRLVQAAE PGDYQQRDVA ADYIQRIADD       480
     VQLDRPLKVV ADAGNGVAGA LAPQLLEAIG AEVIPLYCDV DGTFPNHHPD PSEPANLEDL       540
     VQTVKRFGAD LGVAFDGDGD RLGVVTAEGK IIYADRLLML FAADVLMRNP GAMVIYDVKC       600
     TGKLSDHVLR NGGSPLMWKT GHSLMKAKMR ETDAELAGEM SGHFFFKERW FGFDDGLYAA       660
     ARLLEILAQR EETPDEVLAE LPEMVATPEL KVPVAEGTPH ALVAMLVAAA QSPDNPYVGG       720
     RLSTIDGLRV DFPDGWGLVR ASNTTPVLVL RFEGNDEAAL ERIQALFRSQ LQPVLGDTPL       780
     GF                                                                      782
//

If you have problems or comments...

PBIL Back to PBIL home page