(data stored in ACNUC7421 zone)

EMBL: CP001111.PE287

CP001111.PE287       Location/Qualifiers
FT   CDS             complement(336218..336931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0287"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: xac:XAC0760 two-component
FT                   system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49992"
FT                   /db_xref="GOA:B4STE9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4STE9"
FT                   /protein_id="ACF49992.1"
FT                   /translation="MSPTPIDASVPAARVLVIDDETQIRRFLDISLRAQGYQVRQAATG
FT                   QEGLQLAASEDMDLVILDIGLPDMEGHEVLEQLRQWSQVPVIMLTVRAGETEKVRALDT
FT                   GANDYVTKPFGTQELMARVRALLRTRSVPSDGTPPVFDDGHLHVDLVRREVALDGEPVA
FT                   LTRKEYALLSLLLRNAGRVVTQPQILQEIWGPTHQHDTHYLRILVGKLRHKLGDSALDS
FT                   RYLFTEPGVGLRFKG"
     MSPTPIDASV PAARVLVIDD ETQIRRFLDI SLRAQGYQVR QAATGQEGLQ LAASEDMDLV        60
     ILDIGLPDME GHEVLEQLRQ WSQVPVIMLT VRAGETEKVR ALDTGANDYV TKPFGTQELM       120
     ARVRALLRTR SVPSDGTPPV FDDGHLHVDL VRREVALDGE PVALTRKEYA LLSLLLRNAG       180
     RVVTQPQILQ EIWGPTHQHD THYLRILVGK LRHKLGDSAL DSRYLFTEPG VGLRFKG          237
//

If you have problems or comments...

PBIL Back to PBIL home page