(data stored in ACNUC7421 zone)

EMBL: CP001111.PE288

CP001111.PE288       Location/Qualifiers
FT   CDS             complement(336912..339587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0288"
FT                   /product="osmosensitive K+ channel signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; Osmosensitive K channel
FT                   His kinase sensor; UspA domain protein; KEGG: xcb:XC_3529
FT                   two-component system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49993"
FT                   /db_xref="GOA:B4STF0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF0"
FT                   /protein_id="ACF49993.1"
FT                   /translation="MTAAPMTDARTRQADALVEGLQREAGGKLTVFLGAAPGVGKTYTM
FT                   LTRAQEQLRRGVDLVVGLVETHGRADTQALLEGLPQLPLKEVAYHGHSLQEMDLDAVLA
FT                   RHPALVLVDELAHRNAPGSRHERRWQDVMELLDAGIDVWTTVNIQHLESLNDVVMRITG
FT                   VRVSETVPDGVLDRLHDIVLVDLPPRELIARLQQGKVYVPEQAAQALQAFFSPANLTAL
FT                   RELAMQEAADRVDSSLREARAARGESNLPLRRGVLVAIDGGGQSEYLVRVARRIAERRD
FT                   APWTVVTVQGRRQDEATRREIDAAFALARRLGGDAELLHGSSIADALLDHAAHNGVSTL
FT                   VLGRTRERPLARMFNRTLTQQLIQRGAHYEITIISTPQARARSRREGLLPPVRGISHEP
FT                   AQALIATALACAVAWLAERWVGMADLSMVFIVAVVVVAARTRASVAVMAAILCFLAYNF
FT                   LFIAPRFTFAIGARQGVITVFLFLAAALVAGRLASRLRMQVIALRAANRHARARQQLGR
FT                   QLASAAGNGEVAQAGRLALEQAMDVPAWLRIGTDTAAGGRSQPGDTDLAAADWALRHGQ
FT                   PSGRFTDTLAGAQWWFLPLLDGEDRAIGVAGLYLPGAQARLLPEQRQLAEAMVDDIAQA
FT                   ALRTRLVAELEQAHVSNETERLRSALLSSVSHDLRSPLAAMIGSADSLASYGAAMDTTD
FT                   RRALLDTILVEGERLDRYIQNLLDMTRLGHEGLKINRDWIGVDELIGSAARRLQRYQPK
FT                   VRLELDIPSSLAPIWVHPALVEQAVFNVMENAAKFSPPDAAVQVQARELDGQLRIDVID
FT                   AGPGIPDDERARIFDMFYSVERGDRGRHGTGLGLTICQGMIGAHGGSVQALPGRDGRGT
FT                   LIRITLPLLKPASHDESDPD"
     MTAAPMTDAR TRQADALVEG LQREAGGKLT VFLGAAPGVG KTYTMLTRAQ EQLRRGVDLV        60
     VGLVETHGRA DTQALLEGLP QLPLKEVAYH GHSLQEMDLD AVLARHPALV LVDELAHRNA       120
     PGSRHERRWQ DVMELLDAGI DVWTTVNIQH LESLNDVVMR ITGVRVSETV PDGVLDRLHD       180
     IVLVDLPPRE LIARLQQGKV YVPEQAAQAL QAFFSPANLT ALRELAMQEA ADRVDSSLRE       240
     ARAARGESNL PLRRGVLVAI DGGGQSEYLV RVARRIAERR DAPWTVVTVQ GRRQDEATRR       300
     EIDAAFALAR RLGGDAELLH GSSIADALLD HAAHNGVSTL VLGRTRERPL ARMFNRTLTQ       360
     QLIQRGAHYE ITIISTPQAR ARSRREGLLP PVRGISHEPA QALIATALAC AVAWLAERWV       420
     GMADLSMVFI VAVVVVAART RASVAVMAAI LCFLAYNFLF IAPRFTFAIG ARQGVITVFL       480
     FLAAALVAGR LASRLRMQVI ALRAANRHAR ARQQLGRQLA SAAGNGEVAQ AGRLALEQAM       540
     DVPAWLRIGT DTAAGGRSQP GDTDLAAADW ALRHGQPSGR FTDTLAGAQW WFLPLLDGED       600
     RAIGVAGLYL PGAQARLLPE QRQLAEAMVD DIAQAALRTR LVAELEQAHV SNETERLRSA       660
     LLSSVSHDLR SPLAAMIGSA DSLASYGAAM DTTDRRALLD TILVEGERLD RYIQNLLDMT       720
     RLGHEGLKIN RDWIGVDELI GSAARRLQRY QPKVRLELDI PSSLAPIWVH PALVEQAVFN       780
     VMENAAKFSP PDAAVQVQAR ELDGQLRIDV IDAGPGIPDD ERARIFDMFY SVERGDRGRH       840
     GTGLGLTICQ GMIGAHGGSV QALPGRDGRG TLIRITLPLL KPASHDESDP D                891
//

If you have problems or comments...

PBIL Back to PBIL home page