(data stored in ACNUC7421 zone)

EMBL: CP001111.PE289

CP001111.PE289       Location/Qualifiers
FT   CDS             complement(339624..340274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0289"
FT                   /product="potassium-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="KEGG: xcv:XCV0810 potassium-transporting ATPase
FT                   subunit C; TIGRFAM: potassium-transporting ATPase, C
FT                   subunit; PFAM: K transporting ATPase KdpC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49994"
FT                   /db_xref="GOA:B4STF1"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF1"
FT                   /protein_id="ACF49994.1"
FT                   /translation="MNRTASTSSSLPREQKAEARVASLQDGASWRPAIGLGLATLLLAG
FT                   AVYAGIATGFAGLAYPTQAEGSLLRDGNGQVRGSAWLSQPFTGDGYFQARPSAANYDPM
FT                   AAAGSNLARSNPALAERVAASTAAVAARESVAPAQVPADLVTQSAGGLDPQLSPAAAQL
FT                   QVARVARARGLPVERVQALVQAHTEGRQWGLFGQPRVNVVTLNFALDHAAKAP"
     MNRTASTSSS LPREQKAEAR VASLQDGASW RPAIGLGLAT LLLAGAVYAG IATGFAGLAY        60
     PTQAEGSLLR DGNGQVRGSA WLSQPFTGDG YFQARPSAAN YDPMAAAGSN LARSNPALAE       120
     RVAASTAAVA ARESVAPAQV PADLVTQSAG GLDPQLSPAA AQLQVARVAR ARGLPVERVQ       180
     ALVQAHTEGR QWGLFGQPRV NVVTLNFALD HAAKAP                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page