(data stored in ACNUC7421 zone)

EMBL: CP001111.PE290

CP001111.PE290       Location/Qualifiers
FT   CDS             complement(340271..342328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0290"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; K+-transporting ATPase, B
FT                   subunit; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   xcb:XC_3531 potassium-transporting ATPase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49995"
FT                   /db_xref="GOA:B4STF2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF2"
FT                   /protein_id="ACF49995.1"
FT                   /translation="MSTQASSTRSTHAPRPALLDGAGLRRALIEAVLKLSPMHLVRSPV
FT                   MAVVMAGTIVAAIVTLTGNAPLGFGLAVTAILLVTVLFGNFAEAVAEARGRGQAASLRR
FT                   ARQDLVARRLATPQPGAAETQVPAAELRPGDHVIVSAGELVPADGEIVQGLATINEAAV
FT                   TGESAPVLREAGTDRSGVIGGTKVLSDQIIVRVTAEPGHSFLDRMIALVEGANRQKTPN
FT                   EIALTLLLAAMTLTFLVVVATLPAIGASVGVKVDPLLLIALLVCLIPTTIGGLLPAIGI
FT                   AGMNRALAANVLAKSGKAVEVAGDVDVLLLDKTGTITYGDRQASHFHPLAGIDASQLRE
FT                   AALLSSLADPTPEGKSIVRLAREQGCATAEPDHADYLAFSAQTRMSGVDLEHGRQIRKG
FT                   AADAIRAHVQALGGSVPAELAGRVEQVARNGATPLVVAEGRHVLGVIELSDVVKHGMRE
FT                   KFAQLRAMGIRTVMITGDNPLTAAAIAAEAGVDDYIAEARPEDKLARIRQEQAGGRLVA
FT                   MVGDGTNDAPALAQADIGLAMNSGTQAAKEAGNMVDLDSDPAKLLAVVEVGKQQLITRG
FT                   ALTTFSLANDVSKYFAILPALFAAAVPTMAALNVMQLSSPRNAVLAALIFNALVIPALI
FT                   PLALRGVRFRPATATALLRRNMLVYGLGGVLLPFAAIKAIDLLLVLVFGA"
     MSTQASSTRS THAPRPALLD GAGLRRALIE AVLKLSPMHL VRSPVMAVVM AGTIVAAIVT        60
     LTGNAPLGFG LAVTAILLVT VLFGNFAEAV AEARGRGQAA SLRRARQDLV ARRLATPQPG       120
     AAETQVPAAE LRPGDHVIVS AGELVPADGE IVQGLATINE AAVTGESAPV LREAGTDRSG       180
     VIGGTKVLSD QIIVRVTAEP GHSFLDRMIA LVEGANRQKT PNEIALTLLL AAMTLTFLVV       240
     VATLPAIGAS VGVKVDPLLL IALLVCLIPT TIGGLLPAIG IAGMNRALAA NVLAKSGKAV       300
     EVAGDVDVLL LDKTGTITYG DRQASHFHPL AGIDASQLRE AALLSSLADP TPEGKSIVRL       360
     AREQGCATAE PDHADYLAFS AQTRMSGVDL EHGRQIRKGA ADAIRAHVQA LGGSVPAELA       420
     GRVEQVARNG ATPLVVAEGR HVLGVIELSD VVKHGMREKF AQLRAMGIRT VMITGDNPLT       480
     AAAIAAEAGV DDYIAEARPE DKLARIRQEQ AGGRLVAMVG DGTNDAPALA QADIGLAMNS       540
     GTQAAKEAGN MVDLDSDPAK LLAVVEVGKQ QLITRGALTT FSLANDVSKY FAILPALFAA       600
     AVPTMAALNV MQLSSPRNAV LAALIFNALV IPALIPLALR GVRFRPATAT ALLRRNMLVY       660
     GLGGVLLPFA AIKAIDLLLV LVFGA                                             685
//

If you have problems or comments...

PBIL Back to PBIL home page