(data stored in ACNUC7421 zone)

EMBL: CP001111.PE291

CP001111.PE291       Location/Qualifiers
FT   CDS             complement(342339..344048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0291"
FT                   /product="potassium-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="KEGG: xcb:XC_3532 potassium-transporting ATPase
FT                   subunit A; TIGRFAM: potassium-transporting ATPase, A
FT                   subunit; PFAM: K transporting ATPase A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49996"
FT                   /db_xref="GOA:B4STF3"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:B4STF3"
FT                   /protein_id="ACF49996.1"
FT                   /translation="MTEIIVILAASLLLAWPLGLYLARVMRGAPMKVDVLFHWIEKPLY
FT                   RVFGVDPSRSMSWRGYVLAFVLSNVVVAVLTQAVFMTQAWLPLNPDQIPNMRWDTALHT
FT                   MISFLTNTNQQHYSGQAQLSYLSQMTGITGLQVVTPMMGLALAVATLRALFARSSQAAA
FT                   ASGAGDDRQVAVGNYYVDVVRLCVRFLLPLCLVWTLLLTSQGVPSTMAGGPQATPIDAS
FT                   AGMAEQKLPLGPVAAMVAAKQLGANGGGWYGPNSSFPLENPTPVSNALEILGILLVPMS
FT                   VIFMIGAFTGRRRFGVLVFSCMLGMSLLSTGAMVWSEGHSPSAATPLLMEGKEVRFGAD
FT                   GTALWAAVTTQVSNGSVNGMHDSLAPLSGGIAMVNMLVSAIWGGIGCGLQQFIVYLLLG
FT                   VFLAGLMTGRTPELFGRKLETPQVRLLALLVLLQPITLLVFTAITLAVPGLAGTSNPGF
FT                   HGISQVFYEYVSAYANNGSGFEGLGDATLWWNLSCSLVLLLGRFPLLIIPLVVAAQLAA
FT                   KRQSPESAGSLQIETPTFALTLVSVIVILTVLQFMPALVLGPIADHLSLGLH"
     MTEIIVILAA SLLLAWPLGL YLARVMRGAP MKVDVLFHWI EKPLYRVFGV DPSRSMSWRG        60
     YVLAFVLSNV VVAVLTQAVF MTQAWLPLNP DQIPNMRWDT ALHTMISFLT NTNQQHYSGQ       120
     AQLSYLSQMT GITGLQVVTP MMGLALAVAT LRALFARSSQ AAAASGAGDD RQVAVGNYYV       180
     DVVRLCVRFL LPLCLVWTLL LTSQGVPSTM AGGPQATPID ASAGMAEQKL PLGPVAAMVA       240
     AKQLGANGGG WYGPNSSFPL ENPTPVSNAL EILGILLVPM SVIFMIGAFT GRRRFGVLVF       300
     SCMLGMSLLS TGAMVWSEGH SPSAATPLLM EGKEVRFGAD GTALWAAVTT QVSNGSVNGM       360
     HDSLAPLSGG IAMVNMLVSA IWGGIGCGLQ QFIVYLLLGV FLAGLMTGRT PELFGRKLET       420
     PQVRLLALLV LLQPITLLVF TAITLAVPGL AGTSNPGFHG ISQVFYEYVS AYANNGSGFE       480
     GLGDATLWWN LSCSLVLLLG RFPLLIIPLV VAAQLAAKRQ SPESAGSLQI ETPTFALTLV       540
     SVIVILTVLQ FMPALVLGPI ADHLSLGLH                                         569
//

If you have problems or comments...

PBIL Back to PBIL home page