(data stored in ACNUC7421 zone)

EMBL: CP001111.PE298

CP001111.PE298       Location/Qualifiers
FT   CDS             complement(348463..349599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0298"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   xcb:XC_3927 anhydro-N-acetylmuramic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50003"
FT                   /db_xref="GOA:B4STG0"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:B4STG0"
FT                   /protein_id="ACF50003.1"
FT                   /translation="MPAMNTTADSDAPLYLGLMSGTSADGIDAALVQFPASGGCRFVHG
FT                   LTARWEPVLRARLVALGEGGPLDSLEELGELDARIAIRFAEAANQLLAEAGVDRSQVRA
FT                   IGSHGQTVRHRPLADPAFTVQLGDGNRIAELTGITTVCDFRRRDVAAGGHGAPLMPAFH
FT                   LGMLGTADEDRAVLNLGGIANLTLIPREGAVRGFDTGPANALMDAWCQRHTGRTFDADG
FT                   AYAASGAVDEGLLAGWRSDPWFALPPPKSTGREQFHLAWAEAHMGEGQYAAADIQATLL
FT                   ELTVATVVDALLAQQPRTRRLLVCGGGMRNTQLMRRLAAQLPGVVVESSAVHGLDPEYV
FT                   EAMGFAWLAQRTMDGLAGNLPSVTGAKGPRILGAIHLA"
     MPAMNTTADS DAPLYLGLMS GTSADGIDAA LVQFPASGGC RFVHGLTARW EPVLRARLVA        60
     LGEGGPLDSL EELGELDARI AIRFAEAANQ LLAEAGVDRS QVRAIGSHGQ TVRHRPLADP       120
     AFTVQLGDGN RIAELTGITT VCDFRRRDVA AGGHGAPLMP AFHLGMLGTA DEDRAVLNLG       180
     GIANLTLIPR EGAVRGFDTG PANALMDAWC QRHTGRTFDA DGAYAASGAV DEGLLAGWRS       240
     DPWFALPPPK STGREQFHLA WAEAHMGEGQ YAAADIQATL LELTVATVVD ALLAQQPRTR       300
     RLLVCGGGMR NTQLMRRLAA QLPGVVVESS AVHGLDPEYV EAMGFAWLAQ RTMDGLAGNL       360
     PSVTGAKGPR ILGAIHLA                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page