(data stored in ACNUC7421 zone)

EMBL: CP001111.PE299

CP001111.PE299       Location/Qualifiers
FT   CDS             complement(349655..351127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0299"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Opacity-associated protein A; Peptidase M23;
FT                   KEGG: xcb:XC_3926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50004"
FT                   /db_xref="GOA:B4STG1"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B4STG1"
FT                   /protein_id="ACF50004.1"
FT                   /translation="MHNSEQGRARKQRFQERLHVLHDNALHRKLRQHLPAAFNERWTRR
FT                   HWMHASLFATIGALVATIVPGFSHTIDAPFADSHTSLALPLPPLTMARQQQVPGDSWQV
FT                   LRVQRGQTLSDLFDKAGIPATTLHRVLDHPGAREALTKLRPGAEIAFDMPLSGDLRSIR
FT                   FDRDADNRVELSLSGDDIKEKVTKRETSTRTVVTSGEITSSLYAAARRAGLSPSAIATM
FT                   TDDIFKYDIDFSKDLQPGDRFSVVMDETWREGEKVDTSKILAATFTTGGKTYSGFRFDR
FT                   NGKAEYYDINGRSLKKSFIRMPIPFARLSSTFGARKHPVLGKMRMHKGVDYAARTGTPI
FT                   MAAGDARVQFAGVQRGYGNVVILDHGRGHTTLYGHMSRFASIRTGQRVAQGTVIGYVGS
FT                   TGLATGPHLHYEFRVNGEHRNPLTVTMPPPEPLKGAELVAFRAQTAPAMARIQGMEKLI
FT                   YADASPAPTSRDEAAPEVASAKDKPGNGRKRG"
     MHNSEQGRAR KQRFQERLHV LHDNALHRKL RQHLPAAFNE RWTRRHWMHA SLFATIGALV        60
     ATIVPGFSHT IDAPFADSHT SLALPLPPLT MARQQQVPGD SWQVLRVQRG QTLSDLFDKA       120
     GIPATTLHRV LDHPGAREAL TKLRPGAEIA FDMPLSGDLR SIRFDRDADN RVELSLSGDD       180
     IKEKVTKRET STRTVVTSGE ITSSLYAAAR RAGLSPSAIA TMTDDIFKYD IDFSKDLQPG       240
     DRFSVVMDET WREGEKVDTS KILAATFTTG GKTYSGFRFD RNGKAEYYDI NGRSLKKSFI       300
     RMPIPFARLS STFGARKHPV LGKMRMHKGV DYAARTGTPI MAAGDARVQF AGVQRGYGNV       360
     VILDHGRGHT TLYGHMSRFA SIRTGQRVAQ GTVIGYVGST GLATGPHLHY EFRVNGEHRN       420
     PLTVTMPPPE PLKGAELVAF RAQTAPAMAR IQGMEKLIYA DASPAPTSRD EAAPEVASAK       480
     DKPGNGRKRG                                                              490
//

If you have problems or comments...

PBIL Back to PBIL home page