(data stored in ACNUC7421 zone)

EMBL: CP001111.PE3

CP001111.PE3         Location/Qualifiers
FT   CDS             3921..5015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: xcb:XC_0003 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49708"
FT                   /db_xref="GOA:B4SR07"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SR07"
FT                   /protein_id="ACF49708.1"
FT                   /translation="MQIRRLALHQLRRFNAVELSPQPGLNLLTGDNGAGKTSILEALHL
FT                   MAYGRSFRGRVRDGLVRQGQEALEIFVEWDEQRASHPPHRRKAGLRHSGQDWKGRLDGE
FT                   DVAQLGNLCAALAVVTFEPGSHALVSGGGEPRRRFLDWGLFHVEPDFLSLWRRYSRALK
FT                   QRNALLKQGGPSRMLDTWDHELAEAGEPLTSRRQHYLERLQQRTVALAAELAPQLGIQA
FT                   MELSPGWRRHELPLADALLLARERDRQAGYTSVGPHRADWSVDFHNIPGRDALSRGQAK
FT                   LTALACLLAQAEDYAEQRGEWPVIALDDLASELDRTHQARVLERLLGGPAQIFVTATET
FT                   PAALQELTHIARFHVEHAQIVAVP"
     MQIRRLALHQ LRRFNAVELS PQPGLNLLTG DNGAGKTSIL EALHLMAYGR SFRGRVRDGL        60
     VRQGQEALEI FVEWDEQRAS HPPHRRKAGL RHSGQDWKGR LDGEDVAQLG NLCAALAVVT       120
     FEPGSHALVS GGGEPRRRFL DWGLFHVEPD FLSLWRRYSR ALKQRNALLK QGGPSRMLDT       180
     WDHELAEAGE PLTSRRQHYL ERLQQRTVAL AAELAPQLGI QAMELSPGWR RHELPLADAL       240
     LLARERDRQA GYTSVGPHRA DWSVDFHNIP GRDALSRGQA KLTALACLLA QAEDYAEQRG       300
     EWPVIALDDL ASELDRTHQA RVLERLLGGP AQIFVTATET PAALQELTHI ARFHVEHAQI       360
     VAVP                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page