(data stored in ACNUC7421 zone)

EMBL: CP001111.PE309

CP001111.PE309       Location/Qualifiers
FT   CDS             376629..377105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV4007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50014"
FT                   /db_xref="GOA:B4STH1"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:B4STH1"
FT                   /protein_id="ACF50014.1"
FT                   /translation="MIEVLTAPDGSGTQLRLRPPRALDARQFVLLFAVLSGAMWLVSAF
FT                   GWLAGNAFAPLFALLYSLLLAAALRALWRSGERQEEIRVVPACVEVIPVPGGSPVFRAH
FT                   PHWVRLLTDDEKVRLASSGRQVEVGSFLAPAERQTLVETLEDLLAASDGGNRRR"
     MIEVLTAPDG SGTQLRLRPP RALDARQFVL LFAVLSGAMW LVSAFGWLAG NAFAPLFALL        60
     YSLLLAAALR ALWRSGERQE EIRVVPACVE VIPVPGGSPV FRAHPHWVRL LTDDEKVRLA       120
     SSGRQVEVGS FLAPAERQTL VETLEDLLAA SDGGNRRR                               158
//

If you have problems or comments...

PBIL Back to PBIL home page