(data stored in ACNUC7421 zone)

EMBL: CP001111.PE310

CP001111.PE310       Location/Qualifiers
FT   CDS             377117..378079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0310"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: xac:XAC3888 cytochrome c oxidase subunit II;
FT                   TIGRFAM: cytochrome c oxidase, subunit II; PFAM: cytochrome
FT                   c oxidase subunit II; cytochrome C oxidase subunit II
FT                   transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50015"
FT                   /db_xref="GOA:B4STH2"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B4STH2"
FT                   /protein_id="ACF50015.1"
FT                   /translation="MKQSRGWGTKCVAMVATMAALLSMPGTALAQAADPKPWQLNMGKG
FT                   VTQTSRLAWESNNLSLIVCTVIGVIVFGAMAYAMFKFRKSKGAVAATFSHNTKAEIIWT
FT                   VIPVIILVVMAWPATANLIKMYDTRDAEMTVKVTGYQWMWKYEYLGENVTFTSRLDRES
FT                   DRVRQSGVVPTRESHPHYLLDVDNRLVLPVDTKVRFVITSDDVIHAWWVPALGWKQDAI
FT                   PGFINEAWTSIEQPGVYRGQCAELCGKDHGFMPIVVEAVSKEEFKQWLAQRKPAPPAGP
FT                   ATPAAPAEPAAPAAPASEAPAAPAAAEAGSAPATAASGA"
     MKQSRGWGTK CVAMVATMAA LLSMPGTALA QAADPKPWQL NMGKGVTQTS RLAWESNNLS        60
     LIVCTVIGVI VFGAMAYAMF KFRKSKGAVA ATFSHNTKAE IIWTVIPVII LVVMAWPATA       120
     NLIKMYDTRD AEMTVKVTGY QWMWKYEYLG ENVTFTSRLD RESDRVRQSG VVPTRESHPH       180
     YLLDVDNRLV LPVDTKVRFV ITSDDVIHAW WVPALGWKQD AIPGFINEAW TSIEQPGVYR       240
     GQCAELCGKD HGFMPIVVEA VSKEEFKQWL AQRKPAPPAG PATPAAPAEP AAPAAPASEA       300
     PAAPAAAEAG SAPATAASGA                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page