(data stored in ACNUC7421 zone)

EMBL: CP001111.PE311

CP001111.PE311       Location/Qualifiers
FT   CDS             378139..379746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0311"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: xac:XAC3887 cytochrome c oxidase subunit I;
FT                   TIGRFAM: cytochrome c oxidase, subunit I; PFAM: cytochrome
FT                   c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50016"
FT                   /db_xref="GOA:B4STH3"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B4STH3"
FT                   /protein_id="ACF50016.1"
FT                   /translation="MAHSAVGHDDHHHQQSFFERWFFSTNHKDIGTLYLGFSFIMFIIG
FT                   AAMSVVIRAELAQPGLQFVKPEFFNQMTTVHALVMIFGGVMPAFVGLANWMIPLQIGAP
FT                   DMALPRMNNWSFWLLPVAFSLLLLTLFLPGGAPAGGWTLYPPLSLQGGYNVAFSVFAIH
FT                   VAGISSIMGAINIIATVLNMRAPGIDLLKMPIFCWAWLITAFLLIAVMPVLAGAVTMLL
FT                   TDKFFGTSFFNAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGVVSEIIPTFSRKPLFGY
FT                   QAMVYATAAIAFLSFIVWAHHMFTVGMPLGGEIYFMFATMLISIPTGVKVFNWVSTMWR
FT                   GSLTFEAPMLWSVAFVILFTIGGFSGLMLAIVAADFQYHDTYFVVAHFHYVLVTGAVFA
FT                   LIAAVYYWWPKWTGRMYSEKWAKVHFWWSIVFVNLLFFPQHFLGLAGMPRRIPDYSVAF
FT                   ADWNLISSIGAFGMFATPFMMAAILLSSLRNGEKAEARSWEGARGLEWTLPSPAPAHTF
FT                   TTPPTIRPGDLAHDDISH"
     MAHSAVGHDD HHHQQSFFER WFFSTNHKDI GTLYLGFSFI MFIIGAAMSV VIRAELAQPG        60
     LQFVKPEFFN QMTTVHALVM IFGGVMPAFV GLANWMIPLQ IGAPDMALPR MNNWSFWLLP       120
     VAFSLLLLTL FLPGGAPAGG WTLYPPLSLQ GGYNVAFSVF AIHVAGISSI MGAINIIATV       180
     LNMRAPGIDL LKMPIFCWAW LITAFLLIAV MPVLAGAVTM LLTDKFFGTS FFNAAGGGDP       240
     VMYQHIFWFF GHPEVYIMIL PAFGVVSEII PTFSRKPLFG YQAMVYATAA IAFLSFIVWA       300
     HHMFTVGMPL GGEIYFMFAT MLISIPTGVK VFNWVSTMWR GSLTFEAPML WSVAFVILFT       360
     IGGFSGLMLA IVAADFQYHD TYFVVAHFHY VLVTGAVFAL IAAVYYWWPK WTGRMYSEKW       420
     AKVHFWWSIV FVNLLFFPQH FLGLAGMPRR IPDYSVAFAD WNLISSIGAF GMFATPFMMA       480
     AILLSSLRNG EKAEARSWEG ARGLEWTLPS PAPAHTFTTP PTIRPGDLAH DDISH            535
//

If you have problems or comments...

PBIL Back to PBIL home page