(data stored in ACNUC7421 zone)

EMBL: CP001111.PE313

CP001111.PE313       Location/Qualifiers
FT   CDS             379985..380575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0313"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: xom:XOO_3917 cytochrome c oxidase
FT                   assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50018"
FT                   /db_xref="GOA:B4SHH5"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHH5"
FT                   /protein_id="ACF50018.1"
FT                   /translation="MSEAPASTPSPSAGLPRLIGVAVAVFLLTFSLVPLYRIACEKVFG
FT                   VRLERGPGSEASTGAVTGKRTVRVEFDGGVNSRLPWSFHPEQLTMDVVPGELNEALYFA
FT                   RNDSQQAVVGSAVPSVAPARASGFFSKTECFCFTAQTLQAGEKRDMPVRFIVDPDLPPE
FT                   IKTITLSYTFYRNDALSDRLAPAATSEGAHAAP"
     MSEAPASTPS PSAGLPRLIG VAVAVFLLTF SLVPLYRIAC EKVFGVRLER GPGSEASTGA        60
     VTGKRTVRVE FDGGVNSRLP WSFHPEQLTM DVVPGELNEA LYFARNDSQQ AVVGSAVPSV       120
     APARASGFFS KTECFCFTAQ TLQAGEKRDM PVRFIVDPDL PPEIKTITLS YTFYRNDALS       180
     DRLAPAATSE GAHAAP                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page