(data stored in ACNUC7421 zone)

EMBL: CP001111.PE314

CP001111.PE314       Location/Qualifiers
FT   CDS             380590..381465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0314"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   xcb:XC_3901 cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50019"
FT                   /db_xref="GOA:B4SHH6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHH6"
FT                   /protein_id="ACF50019.1"
FT                   /translation="MAQTPTDANVYFVPAQSKWPFVGSIAMMVTMVGVASWLNDASWGR
FT                   WTFYIGIAMLVLTLFWWFSDVVRESQAGNYNHQVDGSFRMGMIWFIFSEVMFFGAFFGA
FT                   LFYTRNLGLSWLSGEGRGVMTNELLWQGYSAGWPTNGPAAIGGAFQTIPAWGLPLINTL
FT                   ILLTSGVTLTIAHHALKAGNRRQLLIWLGLTVVLGLGFLTLQAEEYIHAYKELNLTLGS
FT                   GIYGSTFFMLTGFHGAHVLLGTIMLIVMWLRSAKGHFTRDNHFGFEAAAWYWHFVDVVW
FT                   LMLFMFVYVL"
     MAQTPTDANV YFVPAQSKWP FVGSIAMMVT MVGVASWLND ASWGRWTFYI GIAMLVLTLF        60
     WWFSDVVRES QAGNYNHQVD GSFRMGMIWF IFSEVMFFGA FFGALFYTRN LGLSWLSGEG       120
     RGVMTNELLW QGYSAGWPTN GPAAIGGAFQ TIPAWGLPLI NTLILLTSGV TLTIAHHALK       180
     AGNRRQLLIW LGLTVVLGLG FLTLQAEEYI HAYKELNLTL GSGIYGSTFF MLTGFHGAHV       240
     LLGTIMLIVM WLRSAKGHFT RDNHFGFEAA AWYWHFVDVV WLMLFMFVYV L                291
//

If you have problems or comments...

PBIL Back to PBIL home page