(data stored in ACNUC7421 zone)

EMBL: CP001111.PE316

CP001111.PE316       Location/Qualifiers
FT   CDS             381762..382490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV4000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50021"
FT                   /db_xref="GOA:B4SHH8"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHH8"
FT                   /protein_id="ACF50021.1"
FT                   /translation="MMRQHTRVIGWLLALLAMAGFSALGLWQLQRMHAKQAMLDAQGPA
FT                   VAQALPLAQALAQALAAPGALHGVADHGRFLPGVVLLDNQTRHGRAGVKIYRPFRSDGG
FT                   SVLLVDLGWRALPPDRTLPDVPAPPSPVAVRGLLAPPPSAGLALGPAFSATDEAGRWLA
FT                   SRLPAEGLAQALGLPALPDRVLRLDPALPFGDERDLDLLPNTLPPQRHLGYAVQWFGLA
FT                   LTVLVVALVLEWRRRRPIAR"
     MMRQHTRVIG WLLALLAMAG FSALGLWQLQ RMHAKQAMLD AQGPAVAQAL PLAQALAQAL        60
     AAPGALHGVA DHGRFLPGVV LLDNQTRHGR AGVKIYRPFR SDGGSVLLVD LGWRALPPDR       120
     TLPDVPAPPS PVAVRGLLAP PPSAGLALGP AFSATDEAGR WLASRLPAEG LAQALGLPAL       180
     PDRVLRLDPA LPFGDERDLD LLPNTLPPQR HLGYAVQWFG LALTVLVVAL VLEWRRRRPI       240
     AR                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page