(data stored in ACNUC7421 zone)

EMBL: CP001111.PE318

CP001111.PE318       Location/Qualifiers
FT   CDS             383167..384330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0318"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG: xac:XAC3880
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50023"
FT                   /db_xref="GOA:B4SHI0"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHI0"
FT                   /protein_id="ACF50023.1"
FT                   /translation="MSLSARPALHRNFHRLAWFAMIMTASTIMFGAFVRLSDAGLSCPD
FT                   WPTCYGQATWPQHVEETLGHPATEIRPLETHKAWREQVHRFLAGALGIEILTLALLATR
FT                   KRRFGSTAVVTACVLVAAGIPLYMMGWHGTASALALIGEAILLIAALRWSNIDLARAAL
FT                   LTLAVVIFQALLGMWTVTLLLKPVVVMGHLLGGMLMFGLLVWMAWRATHMPITLAEAPK
FT                   LKWLLRIGVAVLVTQIALGGWVSANYAALACGGGSASLDNFPRCANQWWPQHNFVEGFT
FT                   LWRGIGVDYEGGVLDGASRIAIQMAHRMFAVVVAVYLLWLGVRLFRLPSMRGWASALIA
FT                   LLVLQVTLGILNVKLALPLEVAVAHNGVAVALLFVLVSLLARLRAPD"
     MSLSARPALH RNFHRLAWFA MIMTASTIMF GAFVRLSDAG LSCPDWPTCY GQATWPQHVE        60
     ETLGHPATEI RPLETHKAWR EQVHRFLAGA LGIEILTLAL LATRKRRFGS TAVVTACVLV       120
     AAGIPLYMMG WHGTASALAL IGEAILLIAA LRWSNIDLAR AALLTLAVVI FQALLGMWTV       180
     TLLLKPVVVM GHLLGGMLMF GLLVWMAWRA THMPITLAEA PKLKWLLRIG VAVLVTQIAL       240
     GGWVSANYAA LACGGGSASL DNFPRCANQW WPQHNFVEGF TLWRGIGVDY EGGVLDGASR       300
     IAIQMAHRMF AVVVAVYLLW LGVRLFRLPS MRGWASALIA LLVLQVTLGI LNVKLALPLE       360
     VAVAHNGVAV ALLFVLVSLL ARLRAPD                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page