(data stored in ACNUC7421 zone)

EMBL: CP001111.PE321

CP001111.PE321       Location/Qualifiers
FT   CDS             complement(386374..387345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0321"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG: xcb:XC_3894
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50026"
FT                   /db_xref="GOA:B4SHI3"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHI3"
FT                   /protein_id="ACF50026.1"
FT                   /translation="MTRWWSRLRPDNFTLALLCTVGLASLLPMKGAAAIVLDDVTTVAI
FT                   AALFFLHGARLPRESIIGGMLHWRLHLTILACTFILFPLLGLMVKPLSGWLLTPELYLG
FT                   VLFLCTLPSTVQSSIAFTSMARGNVPAAVCSASLSSILGVFLTPLLLTALAGTSGGVHD
FT                   PLHAIGGIMLQLLVPFVAGHLLRPWIAGWVEKQRALLRYTDQATILLVVYSAFGEAVTE
FT                   GLWSKTPLLSLLAVAVVAAVLLGIAMPLITFIARRLRFNREDEIAIVFCGSKKSLATGV
FT                   PIAKVLFAGGSLGAIVLPVMIYHQIQLIVCGVIAQRYARRKP"
     MTRWWSRLRP DNFTLALLCT VGLASLLPMK GAAAIVLDDV TTVAIAALFF LHGARLPRES        60
     IIGGMLHWRL HLTILACTFI LFPLLGLMVK PLSGWLLTPE LYLGVLFLCT LPSTVQSSIA       120
     FTSMARGNVP AAVCSASLSS ILGVFLTPLL LTALAGTSGG VHDPLHAIGG IMLQLLVPFV       180
     AGHLLRPWIA GWVEKQRALL RYTDQATILL VVYSAFGEAV TEGLWSKTPL LSLLAVAVVA       240
     AVLLGIAMPL ITFIARRLRF NREDEIAIVF CGSKKSLATG VPIAKVLFAG GSLGAIVLPV       300
     MIYHQIQLIV CGVIAQRYAR RKP                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page