(data stored in ACNUC7421 zone)

EMBL: CP001111.PE325

CP001111.PE325       Location/Qualifiers
FT   CDS             complement(390751..391194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0325"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3873 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50030"
FT                   /db_xref="GOA:B4SHI7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHI7"
FT                   /protein_id="ACF50030.1"
FT                   /translation="MSMKLQLTEDMKAAMKAGEKHKLGVIRLINAAIKQREVDERIELD
FT                   DTAVIAVLDKMVKQRKDSVSQFEAANREDLAEIERAEIVVIEAYLPAKMGEAEIVAAIQ
FT                   AAIAETGASGPTDMGKLMGALKPKLAGQADMGLVSKLVKQQLA"
     MSMKLQLTED MKAAMKAGEK HKLGVIRLIN AAIKQREVDE RIELDDTAVI AVLDKMVKQR        60
     KDSVSQFEAA NREDLAEIER AEIVVIEAYL PAKMGEAEIV AAIQAAIAET GASGPTDMGK       120
     LMGALKPKLA GQADMGLVSK LVKQQLA                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page