(data stored in ACNUC7421 zone)

EMBL: CP001111.PE328

CP001111.PE328       Location/Qualifiers
FT   CDS             complement(392872..393537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0328"
FT                   /product="protein of unknown function DUF1526"
FT                   /note="PFAM: protein of unknown function DUF1526; KEGG:
FT                   pst:PSPTO_0149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50033"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHJ0"
FT                   /protein_id="ACF50033.1"
FT                   /translation="MTMAPHDVLRRALSAERLSTYERIASTCSPDVTAESLYLWNMRMC
FT                   GALMMPVHLCEVVTRNAAATVLARQHGPRWPWNDAFRRRLPTSSCTSARAALEHVAGRT
FT                   TDTPEIVAKLPMVFWQQLFTCRFDDTLWIPALNGVLRHAPSAHPSVIRKAIHADIGRIR
FT                   HLRNRIAHHEPILERDIGADLAAIGRLIHARCPHTLGWLQRHERATTVLAASPLAGRP"
     MTMAPHDVLR RALSAERLST YERIASTCSP DVTAESLYLW NMRMCGALMM PVHLCEVVTR        60
     NAAATVLARQ HGPRWPWNDA FRRRLPTSSC TSARAALEHV AGRTTDTPEI VAKLPMVFWQ       120
     QLFTCRFDDT LWIPALNGVL RHAPSAHPSV IRKAIHADIG RIRHLRNRIA HHEPILERDI       180
     GADLAAIGRL IHARCPHTLG WLQRHERATT VLAASPLAGR P                           221
//

If you have problems or comments...

PBIL Back to PBIL home page