(data stored in ACNUC7421 zone)

EMBL: CP001111.PE33

CP001111.PE33        Location/Qualifiers
FT   CDS             39029..39514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0033"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   xac:XAC0175 transcriptional regulator AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49738"
FT                   /db_xref="GOA:B4SR37"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR37"
FT                   /protein_id="ACF49738.1"
FT                   /translation="MAGEVQFDRTDIRLLAEIQRDGRATNAELATRVNLSPSACLRRLQ
FT                   RLESEGVIVGYGARLEPRQLRLGLQAFVRVQLEKHDQAAIGHFVDSVQAWDEVVACHAL
FT                   TGDMDYLLHVYVRDLEHFSHFLLDRLLNAGGVADANSSFVLRTVKGFQALPLSQLES"
     MAGEVQFDRT DIRLLAEIQR DGRATNAELA TRVNLSPSAC LRRLQRLESE GVIVGYGARL        60
     EPRQLRLGLQ AFVRVQLEKH DQAAIGHFVD SVQAWDEVVA CHALTGDMDY LLHVYVRDLE       120
     HFSHFLLDRL LNAGGVADAN SSFVLRTVKG FQALPLSQLE S                           161
//

If you have problems or comments...

PBIL Back to PBIL home page