(data stored in ACNUC7421 zone)

EMBL: CP001111.PE330

CP001111.PE330       Location/Qualifiers
FT   CDS             394466..395737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0330"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   mxa:MXAN_4113 mechanosensitive ion channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50035"
FT                   /db_xref="GOA:B4SHJ2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHJ2"
FT                   /protein_id="ACF50035.1"
FT                   /translation="MVDAVVAVQWLERLQNTLEPYPGAYLALMITALLVAAGLANWVTK
FT                   RILVRGLRRLLQRLPGAESGRGSHLMRVISRLSNVVPSQVIASGITLIPDLPPGLVNVI
FT                   IKLCIVWAVLTVSMAFSHALDAANSLYERKPDARNKPIKGYLQVVKIVVFVAAGLSIIA
FT                   TLLGVKLGPLVTGLGAATAVLMLIFQDTILSLVASVQISGDGRVRIGDWIEMPSQNADG
FT                   DVIDIALHTVTVQNFDKTITTIPTKKLVTESFKNWRGMQEAGGRRIKRALYLDQHSVGF
FT                   LDEGDLAFLGQFALLRDYLQEKEQELGQWNGRLREQGVAEVNSRRVTNLGTFRAYVERY
FT                   LRNHPGIHTDMTLLVRQLQPTTEGLPLELYCFTRSTAWGEYESVQSDIFDHLLAILPAF
FT                   GLRVFQASSDAMLMAGQRQLAGSE"
     MVDAVVAVQW LERLQNTLEP YPGAYLALMI TALLVAAGLA NWVTKRILVR GLRRLLQRLP        60
     GAESGRGSHL MRVISRLSNV VPSQVIASGI TLIPDLPPGL VNVIIKLCIV WAVLTVSMAF       120
     SHALDAANSL YERKPDARNK PIKGYLQVVK IVVFVAAGLS IIATLLGVKL GPLVTGLGAA       180
     TAVLMLIFQD TILSLVASVQ ISGDGRVRIG DWIEMPSQNA DGDVIDIALH TVTVQNFDKT       240
     ITTIPTKKLV TESFKNWRGM QEAGGRRIKR ALYLDQHSVG FLDEGDLAFL GQFALLRDYL       300
     QEKEQELGQW NGRLREQGVA EVNSRRVTNL GTFRAYVERY LRNHPGIHTD MTLLVRQLQP       360
     TTEGLPLELY CFTRSTAWGE YESVQSDIFD HLLAILPAFG LRVFQASSDA MLMAGQRQLA       420
     GSE                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page