(data stored in ACNUC7421 zone)

EMBL: CP001111.PE331

CP001111.PE331       Location/Qualifiers
FT   CDS             395866..398040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0331"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: xcb:XC_3886 beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50036"
FT                   /db_xref="GOA:B4SHJ3"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHJ3"
FT                   /protein_id="ACF50036.1"
FT                   /translation="MASDRIESLIAQMTVEEKVGQLGVFADMVRPFAPDVNPEANVRNA
FT                   DQVLQQVREGKVGSLFNGVGAELGRRIQQVATEESRLGIPVILAADVIHGMRTVFPIPL
FT                   GEAASFEPELAERTARATAVEATAAGLHWTYAPAVDIARDQRWGRGAEGAGEDVVLGCA
FT                   FAAARVRGFQGSDLRADDSLLATPKHFAAYGAVMAGMEYNMVDISPQTLRDVHLPPFKA
FT                   AFDAGAITVMSSFNDINGVPASANAELLTDILRGEWKFPGVVISDYTADMELVAHGYAA
FT                   DDRDATAKAFTAGLDLSMQSGFYAEHLPGLVESGDVPMAVLDEGVRRILWLKETIGLFD
FT                   DPYRSLDPAREADTSHIADHDELSRDAARRSIVLLNNRDNVLPLQKTGQKIALIGPFVQ
FT                   DRENIEGCWTLFGDKQRYVDLETGVRAAIGDESLLEIVPGCELEVAIPGGTEAAVAAAL
FT                   RADVVVLALGEPQRYSGEAQSRVEITLPPAQQALAEAVAMTGKPLVVLLRNGRALALQG
FT                   AVRNAQAVAVTWYLGTQTGHAVADVLFGDYSPSGRLPVSFPQVSGQQPYFYNHPRTGRP
FT                   ELPTMSEFKARWREIPNEPLYPFGHGIGYTTFAYGVPQLSAAQLGWDDTLTITTTLTNS
FT                   GDVAGEEVVQLYIHDRVASRVRPVRELKDFRKVALQPGESTEVVFTLSREQLAFTGRDG
FT                   VLRAEPGQFDVWVCASSAVGEAVQFELLKA"
     MASDRIESLI AQMTVEEKVG QLGVFADMVR PFAPDVNPEA NVRNADQVLQ QVREGKVGSL        60
     FNGVGAELGR RIQQVATEES RLGIPVILAA DVIHGMRTVF PIPLGEAASF EPELAERTAR       120
     ATAVEATAAG LHWTYAPAVD IARDQRWGRG AEGAGEDVVL GCAFAAARVR GFQGSDLRAD       180
     DSLLATPKHF AAYGAVMAGM EYNMVDISPQ TLRDVHLPPF KAAFDAGAIT VMSSFNDING       240
     VPASANAELL TDILRGEWKF PGVVISDYTA DMELVAHGYA ADDRDATAKA FTAGLDLSMQ       300
     SGFYAEHLPG LVESGDVPMA VLDEGVRRIL WLKETIGLFD DPYRSLDPAR EADTSHIADH       360
     DELSRDAARR SIVLLNNRDN VLPLQKTGQK IALIGPFVQD RENIEGCWTL FGDKQRYVDL       420
     ETGVRAAIGD ESLLEIVPGC ELEVAIPGGT EAAVAAALRA DVVVLALGEP QRYSGEAQSR       480
     VEITLPPAQQ ALAEAVAMTG KPLVVLLRNG RALALQGAVR NAQAVAVTWY LGTQTGHAVA       540
     DVLFGDYSPS GRLPVSFPQV SGQQPYFYNH PRTGRPELPT MSEFKARWRE IPNEPLYPFG       600
     HGIGYTTFAY GVPQLSAAQL GWDDTLTITT TLTNSGDVAG EEVVQLYIHD RVASRVRPVR       660
     ELKDFRKVAL QPGESTEVVF TLSREQLAFT GRDGVLRAEP GQFDVWVCAS SAVGEAVQFE       720
     LLKA                                                                    724
//

If you have problems or comments...

PBIL Back to PBIL home page