(data stored in ACNUC7421 zone)

EMBL: CP001111.PE332

CP001111.PE332       Location/Qualifiers
FT   CDS             398172..398708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gvi:gsl1632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50037"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHJ4"
FT                   /protein_id="ACF50037.1"
FT                   /translation="MRMIAVLIPALFLAACSQPPAEPAVDAPPPMEASAAATPAAEPAK
FT                   AAAEPAGAAPTDAPAEDARARIESLLGDAAQYEKVFNAFRTAVVGGDRAAVVEEVRFPL
FT                   NIANGKKITGPGEFQRSYEKIITPAVVKAVSEQDFGKVFVNQQGVMIGDGQVWLNGQCL
FT                   DQACTKTEVKVITIQ"
     MRMIAVLIPA LFLAACSQPP AEPAVDAPPP MEASAAATPA AEPAKAAAEP AGAAPTDAPA        60
     EDARARIESL LGDAAQYEKV FNAFRTAVVG GDRAAVVEEV RFPLNIANGK KITGPGEFQR       120
     SYEKIITPAV VKAVSEQDFG KVFVNQQGVM IGDGQVWLNG QCLDQACTKT EVKVITIQ         178
//

If you have problems or comments...

PBIL Back to PBIL home page