(data stored in ACNUC7421 zone)

EMBL: CP001111.PE340

CP001111.PE340       Location/Qualifiers
FT   CDS             complement(405539..406978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0340"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: xcv:XCV3979
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50045"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR027017"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039439"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK2"
FT                   /protein_id="ACF50045.1"
FT                   /translation="MILASREPRRHWPRRLTLALCLLAAPAFAQATPAPDPGAPLPYVI
FT                   GLHEAYLTPGYWAARLENADTPILDRMQIDAQNARMRAQDRHIQDIAVLPAQLDAAAVR
FT                   GSITALSSWPTRTLYNDEGQAITPALRSAIEANLGLDAIPAQTTPQYGLVVKRAALRTF
FT                   PTRERVFSTVGDTDIDRFQESALFPGDKVAVVHRSADGRWLFVHSERYSAWIEADAIAS
FT                   GDKATVLGYGAKGPYRIVTGATAQTAYTPEEPRVSRLQLDMGVRLPVLADWPAAEPVNG
FT                   QQAHAAWVVQLPVRESDGRLKLVPALLPRSQDTAADYLPLTPRLLLQQAFKFLGERYGW
FT                   GHDYDTRDCSGFVSEIYRSFGVLLPRNTSAQAVSPALDRVPFTGKDGKAVRDSAVTDLQ
FT                   VGDLVYIPGHVMMAIGHVDGRTWVIHDTAGGSWYGADGKRVQAHLNGVSVTPLEPMMAS
FT                   DSVRYIDRITNIQRLRAKTPE"
     MILASREPRR HWPRRLTLAL CLLAAPAFAQ ATPAPDPGAP LPYVIGLHEA YLTPGYWAAR        60
     LENADTPILD RMQIDAQNAR MRAQDRHIQD IAVLPAQLDA AAVRGSITAL SSWPTRTLYN       120
     DEGQAITPAL RSAIEANLGL DAIPAQTTPQ YGLVVKRAAL RTFPTRERVF STVGDTDIDR       180
     FQESALFPGD KVAVVHRSAD GRWLFVHSER YSAWIEADAI ASGDKATVLG YGAKGPYRIV       240
     TGATAQTAYT PEEPRVSRLQ LDMGVRLPVL ADWPAAEPVN GQQAHAAWVV QLPVRESDGR       300
     LKLVPALLPR SQDTAADYLP LTPRLLLQQA FKFLGERYGW GHDYDTRDCS GFVSEIYRSF       360
     GVLLPRNTSA QAVSPALDRV PFTGKDGKAV RDSAVTDLQV GDLVYIPGHV MMAIGHVDGR       420
     TWVIHDTAGG SWYGADGKRV QAHLNGVSVT PLEPMMASDS VRYIDRITNI QRLRAKTPE        479
//

If you have problems or comments...

PBIL Back to PBIL home page