(data stored in ACNUC7421 zone)

EMBL: CP001111.PE342

CP001111.PE342       Location/Qualifiers
FT   CDS             408653..411676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0342"
FT                   /product="TonB-dependent receptor plug"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: saz:Sama_3060 TonB-dependent receptor,
FT                   plug"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50047"
FT                   /db_xref="GOA:B4SHK4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK4"
FT                   /protein_id="ACF50047.1"
FT                   /translation="MKAYTIKRAALCVALGACLGAMLPSIALAQNVSGAVAGRATAGDQ
FT                   VTVVSSSTGLTRTVTVGADGSYRLGQLPVGDYQLQLSREGQALGDQVAVSVAVGGTTTV
FT                   NLASGGGVTNLDALQVRGTRVINRVDVYSTETSFNINRQEISRLPVAQDLSAVALMAPG
FT                   VVGGNSSFGGLSFAGSSVAENAVFINGLNVTDMYTRRGFSTAPFAFFNEFQVKTGGYSV
FT                   EFGRSTGGVINAVTRSGSNVFEGGVEVTAEPSAWRSSGGDHFHRDGTPHSYGSRDNNSF
FT                   LKTNVWGSGPIIKDKLFLFAMYEDRSDKGHNTSSDGSTWFKNDSGNGFWGTKLDWNIND
FT                   NHSLALLAFSDEGDVTNASYGYNWNNDRLGAWGGDSITETGGRNWSATYTGHFGQNFTA
FT                   RAMVGQNKQRAFTNSSLDQACSPVFTDSTYGPRLGKLQGLRAGCHPTGTAVAERDDTRD
FT                   VARLDFEWQLGDHLLRFGVDRELMTTDQSTRYPGPTALSYTAYVARPGDEVWDGANAYV
FT                   PAGVTEMLRARNRQSGGKFETEANAFYLEDIWNITPNLMLNLGVRWDRFENRTAAGKAF
FT                   IKMDDLIAPRVGFSWDMRGDGSTKLFGNAGRYYLPVTNNINVNFAGGLTDEYSYYVLNG
FT                   WEQKTSPTGSPYMAPIVGQQIGPTDTRMNTGGADLRQSVDRDLKAVYQDEYILGFQNMI
FT                   NQAWSWGVNATYRRMTRALDDIRINYTPCGPTPSTLWPIANPGESLTIWGDKSIGCANE
FT                   GWITIDTANSGYRKGGSGEVIGYSKPKRTYKALEFQIDRAWDEKWMLNASYLWSKSEGN
FT                   FEGPVNSDTNYGDTGMVQFWDHPATNERYGVLFNDFRHQFKLRAAYALNKQWSFGTTLQ
FT                   VQSGGPITAYGVMWPNDSIAGGSTSSEGSGGGTGWLCVANCSGPYDKRQFEYSPRGAFG
FT                   RLPWTWTMGANVTWRLPVEGIDLSARLSVYNLFNNQKTINVHQRYEAQPGQYREATFAT
FT                   GTRWQAPRYTQLVVTWNF"
     MKAYTIKRAA LCVALGACLG AMLPSIALAQ NVSGAVAGRA TAGDQVTVVS SSTGLTRTVT        60
     VGADGSYRLG QLPVGDYQLQ LSREGQALGD QVAVSVAVGG TTTVNLASGG GVTNLDALQV       120
     RGTRVINRVD VYSTETSFNI NRQEISRLPV AQDLSAVALM APGVVGGNSS FGGLSFAGSS       180
     VAENAVFING LNVTDMYTRR GFSTAPFAFF NEFQVKTGGY SVEFGRSTGG VINAVTRSGS       240
     NVFEGGVEVT AEPSAWRSSG GDHFHRDGTP HSYGSRDNNS FLKTNVWGSG PIIKDKLFLF       300
     AMYEDRSDKG HNTSSDGSTW FKNDSGNGFW GTKLDWNIND NHSLALLAFS DEGDVTNASY       360
     GYNWNNDRLG AWGGDSITET GGRNWSATYT GHFGQNFTAR AMVGQNKQRA FTNSSLDQAC       420
     SPVFTDSTYG PRLGKLQGLR AGCHPTGTAV AERDDTRDVA RLDFEWQLGD HLLRFGVDRE       480
     LMTTDQSTRY PGPTALSYTA YVARPGDEVW DGANAYVPAG VTEMLRARNR QSGGKFETEA       540
     NAFYLEDIWN ITPNLMLNLG VRWDRFENRT AAGKAFIKMD DLIAPRVGFS WDMRGDGSTK       600
     LFGNAGRYYL PVTNNINVNF AGGLTDEYSY YVLNGWEQKT SPTGSPYMAP IVGQQIGPTD       660
     TRMNTGGADL RQSVDRDLKA VYQDEYILGF QNMINQAWSW GVNATYRRMT RALDDIRINY       720
     TPCGPTPSTL WPIANPGESL TIWGDKSIGC ANEGWITIDT ANSGYRKGGS GEVIGYSKPK       780
     RTYKALEFQI DRAWDEKWML NASYLWSKSE GNFEGPVNSD TNYGDTGMVQ FWDHPATNER       840
     YGVLFNDFRH QFKLRAAYAL NKQWSFGTTL QVQSGGPITA YGVMWPNDSI AGGSTSSEGS       900
     GGGTGWLCVA NCSGPYDKRQ FEYSPRGAFG RLPWTWTMGA NVTWRLPVEG IDLSARLSVY       960
     NLFNNQKTIN VHQRYEAQPG QYREATFATG TRWQAPRYTQ LVVTWNF                    1007
//

If you have problems or comments...

PBIL Back to PBIL home page