(data stored in ACNUC7421 zone)

EMBL: CP001111.PE345

CP001111.PE345       Location/Qualifiers
FT   CDS             414164..414535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50050"
FT                   /db_xref="GOA:B4SHK7"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK7"
FT                   /protein_id="ACF50050.1"
FT                   /translation="MNLPLHFGLLGTLEAGAIALLVGLLVYFLWSQLCRLLHWTVGHAI
FT                   GWSCVIAVIISAGIDAWKLFYMGIVRLESPLYARLFLATIHDPNELGSRVVLEIAGALA
FT                   GVALGWVMFSSRSSAQNVD"
     MNLPLHFGLL GTLEAGAIAL LVGLLVYFLW SQLCRLLHWT VGHAIGWSCV IAVIISAGID        60
     AWKLFYMGIV RLESPLYARL FLATIHDPNE LGSRVVLEIA GALAGVALGW VMFSSRSSAQ       120
     NVD                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page