(data stored in ACNUC7421 zone)

EMBL: CP001111.PE346

CP001111.PE346       Location/Qualifiers
FT   CDS             414768..415178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0346"
FT                   /product="Calcium-binding EF-hand-containing protein"
FT                   /note="PFAM: Calcium-binding EF-hand-containing protein;
FT                   KEGG: xac:XAC3856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50051"
FT                   /db_xref="GOA:B4SHK8"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHK8"
FT                   /protein_id="ACF50051.1"
FT                   /translation="MTIRNRKPLIALIVAAGSVLAIPAMAQSAKQQAAQAQNEAAQAQQ
FT                   SAAQAGQAADQATNAAAAASAQANGGGQTWASIDTDGNGTISKTEAQVNAGLAQVFDQA
FT                   DTNKDGELSADEYKAYVAAQQAGAGAGAAQGR"
     MTIRNRKPLI ALIVAAGSVL AIPAMAQSAK QQAAQAQNEA AQAQQSAAQA GQAADQATNA        60
     AAAASAQANG GGQTWASIDT DGNGTISKTE AQVNAGLAQV FDQADTNKDG ELSADEYKAY       120
     VAAQQAGAGA GAAQGR                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page