(data stored in ACNUC7421 zone)

EMBL: CP001111.PE349

CP001111.PE349       Location/Qualifiers
FT   CDS             416709..418073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0349"
FT                   /product="protein of unknown function DUF1338"
FT                   /note="PFAM: protein of unknown function DUF1338; KEGG:
FT                   xcc:XCC3793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50054"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHL1"
FT                   /protein_id="ACF50054.1"
FT                   /translation="MSASFVSPDVIRRLFAQAMSRMYRTEVPLYGTLVELVERINAQVL
FT                   DQDPALAAQLQRNDERARLDEERHGAIRVGTVQELATLRRLFAVMGMYPVGYYDLSVAG
FT                   VPVHSTAFRPLTGAALAQNPFRVFTSLLRLELIEDETLRAESAKILARRRIFTDGALAL
FT                   IDQAERDGGLSQADAERFVDEALETFRWHGDATVDLPTYHALHNAHRLVADVVSFRGPH
FT                   INHLTPRTLDIDAAQAAMIEYGMAAKAVIEGPPRRACPILLRQTSFKALEEAVQFPDSE
FT                   GGDAGTHTARFGEIEQRGLALTPKGRALYDQLLSQARDAGGEGSTGGDYGQRLQAVFAS
FT                   FPDDHDTLRQEGLGYYRYQLTDAGRAAPERVADLPAEVLVAAGLATADPIVYEDFLPVS
FT                   AAGIFQSNLGGEEQRAYAAHANREAFEQALGVAVHDEFEIYERLQAESLAALRTA"
     MSASFVSPDV IRRLFAQAMS RMYRTEVPLY GTLVELVERI NAQVLDQDPA LAAQLQRNDE        60
     RARLDEERHG AIRVGTVQEL ATLRRLFAVM GMYPVGYYDL SVAGVPVHST AFRPLTGAAL       120
     AQNPFRVFTS LLRLELIEDE TLRAESAKIL ARRRIFTDGA LALIDQAERD GGLSQADAER       180
     FVDEALETFR WHGDATVDLP TYHALHNAHR LVADVVSFRG PHINHLTPRT LDIDAAQAAM       240
     IEYGMAAKAV IEGPPRRACP ILLRQTSFKA LEEAVQFPDS EGGDAGTHTA RFGEIEQRGL       300
     ALTPKGRALY DQLLSQARDA GGEGSTGGDY GQRLQAVFAS FPDDHDTLRQ EGLGYYRYQL       360
     TDAGRAAPER VADLPAEVLV AAGLATADPI VYEDFLPVSA AGIFQSNLGG EEQRAYAAHA       420
     NREAFEQALG VAVHDEFEIY ERLQAESLAA LRTA                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page