(data stored in ACNUC7421 zone)

EMBL: CP001111.PE353

CP001111.PE353       Location/Qualifiers
FT   CDS             complement(423830..424345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV0584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50058"
FT                   /db_xref="GOA:B4SHL5"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHL5"
FT                   /protein_id="ACF50058.1"
FT                   /translation="MFRCLRVPATALLLSALVVPTVHAGAAPQLNSGQTSVLVTSLIVL
FT                   SIPLATSMGLAELSKAPFKASERNGKVAARTPAVPLPPMEVKQVATTPAGDRQVHLQVP
FT                   GKADQTATLQWPAAAGDDPIAGFVVGQQVRFDPTDAGAGWTVKSAQGQALAYVPTAYAA
FT                   GDVMSETL"
     MFRCLRVPAT ALLLSALVVP TVHAGAAPQL NSGQTSVLVT SLIVLSIPLA TSMGLAELSK        60
     APFKASERNG KVAARTPAVP LPPMEVKQVA TTPAGDRQVH LQVPGKADQT ATLQWPAAAG       120
     DDPIAGFVVG QQVRFDPTDA GAGWTVKSAQ GQALAYVPTA YAAGDVMSET L                171
//

If you have problems or comments...

PBIL Back to PBIL home page