(data stored in ACNUC7421 zone)

EMBL: CP001111.PE354

CP001111.PE354       Location/Qualifiers
FT   CDS             complement(424378..424881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcc:XCC3602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50059"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHL6"
FT                   /protein_id="ACF50059.1"
FT                   /translation="MRTLPAVLMPMLIVASLAWSTAAHAERRIVIIHDPGPQGPSLEMS
FT                   TQMVTSARAAAAKEAQDAADAGRPLARPQQIKLPQMQVSAIATTVDGRREVLLRDANDP
FT                   QNTASMQYPRGIGDPAVQFTVGQTVNFEPTGADQGWQLKDNQGRPLEYLPEATGPRDIF
FT                   DTRH"
     MRTLPAVLMP MLIVASLAWS TAAHAERRIV IIHDPGPQGP SLEMSTQMVT SARAAAAKEA        60
     QDAADAGRPL ARPQQIKLPQ MQVSAIATTV DGRREVLLRD ANDPQNTASM QYPRGIGDPA       120
     VQFTVGQTVN FEPTGADQGW QLKDNQGRPL EYLPEATGPR DIFDTRH                     167
//

If you have problems or comments...

PBIL Back to PBIL home page