(data stored in ACNUC7421 zone)

EMBL: CP001111.PE355

CP001111.PE355       Location/Qualifiers
FT   CDS             complement(424901..425752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV0585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50060"
FT                   /db_xref="InterPro:IPR014547"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHL7"
FT                   /protein_id="ACF50060.1"
FT                   /translation="MDRFSRLPRAALLIASLLATAPARANSTECRERYPSVAAQAAMLD
FT                   VAWTTAERLDALPDVDVVVAARGGQDLSRYGLRHSHLAFLVREDNGRWRAMHLLNRCKT
FT                   DSSQLYHEGLGNFVGESGGHTDLRIGVPSAPLRAALKAMLVSPSIQPKALHETRYNVVA
FT                   YPFATDYQNSNQWVLEVLAAAMAQAEGAPAIVKREQAQQWLRQQKYQPSVLHIGLGKRV
FT                   GARLFVANATTTDHPAGERISGNYSVVTVESVFDFLHQRSQLQQELVIPHVPVAGAAAA
FT                   TP"
     MDRFSRLPRA ALLIASLLAT APARANSTEC RERYPSVAAQ AAMLDVAWTT AERLDALPDV        60
     DVVVAARGGQ DLSRYGLRHS HLAFLVREDN GRWRAMHLLN RCKTDSSQLY HEGLGNFVGE       120
     SGGHTDLRIG VPSAPLRAAL KAMLVSPSIQ PKALHETRYN VVAYPFATDY QNSNQWVLEV       180
     LAAAMAQAEG APAIVKREQA QQWLRQQKYQ PSVLHIGLGK RVGARLFVAN ATTTDHPAGE       240
     RISGNYSVVT VESVFDFLHQ RSQLQQELVI PHVPVAGAAA ATP                         283
//

If you have problems or comments...

PBIL Back to PBIL home page