(data stored in ACNUC7421 zone)

EMBL: CP001111.PE359

CP001111.PE359       Location/Qualifiers
FT   CDS             427981..428688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0359"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: xac:XAC0555
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50064"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHM1"
FT                   /protein_id="ACF50064.1"
FT                   /translation="MSATRKLLLPLALTLAIAACSKPADTAAPAADAAAPATTEQAATP
FT                   AADAAAAAPAAEAIQIASGTYKLDPTHTDVLAQWSHFGFSNPSAHFGNVEGTLVYNAED
FT                   VTKSTVEVKLPLSGLNSFTAKFDEHLKSADFFDAAKFADATFKSTKVEAAGTNKLTVTG
FT                   DLTIKGITKPVTLDVTVNGGGEHPMAKVPAAGFDATTTLKRSDFGVGAYAPNVSDEVKI
FT                   RITTEATGEKPAA"
     MSATRKLLLP LALTLAIAAC SKPADTAAPA ADAAAPATTE QAATPAADAA AAAPAAEAIQ        60
     IASGTYKLDP THTDVLAQWS HFGFSNPSAH FGNVEGTLVY NAEDVTKSTV EVKLPLSGLN       120
     SFTAKFDEHL KSADFFDAAK FADATFKSTK VEAAGTNKLT VTGDLTIKGI TKPVTLDVTV       180
     NGGGEHPMAK VPAAGFDATT TLKRSDFGVG AYAPNVSDEV KIRITTEATG EKPAA            235
//

If you have problems or comments...

PBIL Back to PBIL home page