(data stored in ACNUC7421 zone)

EMBL: CP001111.PE36

CP001111.PE36        Location/Qualifiers
FT   CDS             complement(41729..42745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0036"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   xac:XAC0178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49741"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR025640"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR40"
FT                   /protein_id="ACF49741.1"
FT                   /translation="MTQWYFHAFAQAERIGPLDDEAARRYAQANPRALAWCQGMSGWTS
FT                   IAEVPELQSAAPGMPNTPPPVPATASGRADDIEFRIVGHEMQFVEIELDPGESAIAEAG
FT                   ALMFKDATVQMDTVFGAATGDQGGGLMGKVMAAGKRVLTGESLFATVYTQSGHGKGKVA
FT                   FAAPYPGTVLAMKLDQHGGRLICQKDSFLAGARGVQIGVQFQRKIMTGLFGGEGFIMQK
FT                   LEGDGWVFIHAGGCVVERELAAGERLDVDTGCVVAYHPTVDMDVRRVAGIKSMLFGGEG
FT                   VFLATLTGPGKVWLQSLPFSRLAGRMWMAAPQGGGQNRGEGSVLGGLGRMLDGDNRF"
     MTQWYFHAFA QAERIGPLDD EAARRYAQAN PRALAWCQGM SGWTSIAEVP ELQSAAPGMP        60
     NTPPPVPATA SGRADDIEFR IVGHEMQFVE IELDPGESAI AEAGALMFKD ATVQMDTVFG       120
     AATGDQGGGL MGKVMAAGKR VLTGESLFAT VYTQSGHGKG KVAFAAPYPG TVLAMKLDQH       180
     GGRLICQKDS FLAGARGVQI GVQFQRKIMT GLFGGEGFIM QKLEGDGWVF IHAGGCVVER       240
     ELAAGERLDV DTGCVVAYHP TVDMDVRRVA GIKSMLFGGE GVFLATLTGP GKVWLQSLPF       300
     SRLAGRMWMA APQGGGQNRG EGSVLGGLGR MLDGDNRF                               338
//

If you have problems or comments...

PBIL Back to PBIL home page