(data stored in ACNUC7421 zone)

EMBL: CP001111.PE360

CP001111.PE360       Location/Qualifiers
FT   CDS             complement(429204..429605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50065"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHM2"
FT                   /protein_id="ACF50065.1"
FT                   /translation="MAKLTLASVDALRTRFADDAACDTALAAFADPAALRAPLRELVEA
FT                   QHRYLQAEFEVAQVADVLRRDQKYAPVGRPSINIVQLRKQQAATKQAALIARQVVAQAA
FT                   QTFARASGMTVKAKQSPSEACVAWLGALR"
     MAKLTLASVD ALRTRFADDA ACDTALAAFA DPAALRAPLR ELVEAQHRYL QAEFEVAQVA        60
     DVLRRDQKYA PVGRPSINIV QLRKQQAATK QAALIARQVV AQAAQTFARA SGMTVKAKQS       120
     PSEACVAWLG ALR                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page