(data stored in ACNUC7421 zone)

EMBL: CP001111.PE361

CP001111.PE361       Location/Qualifiers
FT   CDS             429842..430786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0361"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bpe:BP3519
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50066"
FT                   /db_xref="GOA:B4SHM3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHM3"
FT                   /protein_id="ACF50066.1"
FT                   /translation="MNNHKNARLTPFSRALLVRRILHEGLRPEEAAQACGVSVRTAYKW
FT                   LARFRQFGAPGLENRSSRPHQTPHATPAPVVEQIKEHRRKRQTYLTISKALGVGHSTIS
FT                   RLMRAHGLNRLCRLDPPKEVIRYEYDQPGGLLHLDIKKLGNFQRPGHRTDAKRRGNAAG
FT                   GGWGYVHVAIDDHSRVAFSSVHPNEQGETACQALLGALEYYASLGITFKRILTDNGACY
FT                   RSTAFAKLLKSLGIKHIRTKPYTPRTNGKAERFIQTSLREWAYACEYASSDQRNSVLNQ
FT                   WLHHYNWHRPHMAIGGQPPISRVRLNNVVGLHN"
     MNNHKNARLT PFSRALLVRR ILHEGLRPEE AAQACGVSVR TAYKWLARFR QFGAPGLENR        60
     SSRPHQTPHA TPAPVVEQIK EHRRKRQTYL TISKALGVGH STISRLMRAH GLNRLCRLDP       120
     PKEVIRYEYD QPGGLLHLDI KKLGNFQRPG HRTDAKRRGN AAGGGWGYVH VAIDDHSRVA       180
     FSSVHPNEQG ETACQALLGA LEYYASLGIT FKRILTDNGA CYRSTAFAKL LKSLGIKHIR       240
     TKPYTPRTNG KAERFIQTSL REWAYACEYA SSDQRNSVLN QWLHHYNWHR PHMAIGGQPP       300
     ISRVRLNNVV GLHN                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page