(data stored in ACNUC7421 zone)

EMBL: CP001111.PE365

CP001111.PE365       Location/Qualifiers
FT   CDS             433739..436426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0365"
FT                   /product="2-oxo-acid dehydrogenase E1 subunit, homodimeric
FT                   type"
FT                   /EC_number="1.2.4.1"
FT                   /note="TIGRFAM: 2-oxo-acid dehydrogenase E1 subunit,
FT                   homodimeric type; KEGG: xcv:XCV0611 pyruvate dehydrogenase
FT                   subunit E1"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50070"
FT                   /db_xref="GOA:B4SHM7"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHM7"
FT                   /protein_id="ACF50070.1"
FT                   /translation="MNWLNEVLNNDPNPVETQEWIESLKAVIDVEGSERAHQLLEGMVE
FT                   LTRRSGAYLPFSPTTEYVNTIEPQLEAKSPGNAELEWRIRSIIRWNAMATVVRANRKPG
FT                   DLGGHIASFASGATLYDVGFNHFWRAPSENHPGDLLFIQGHSAPGIYARSFLEGRISEE
FT                   QLDKFRMEVDGGGLSSYPHPWLMPEYWQTPTVSMGLGPLAAIYQAQFMRYLENRGLIEK
FT                   SDRKVWCFIGDGESDEPETLGAIALAGREGLDNLIFVVNCNLQRLDGPVRGNGKIIQEL
FT                   EGVFRGGGWNVIKLLWGGYWDALLAKDSDGVLKKLMMETVDGEYQNCKAFGGAYTREHF
FT                   FGKYPETAAMVAGLSDDDIWRLNRGGHDPHKVYAAYHQAVNTKGMPTVILAKTVKGYGM
FT                   GSAGEALNPTHQTKKLDDEAVRHFRDRFNIPVTDAQLADGQVPFYHPGPDSPEVQYLQE
FT                   RRAALGGYLPQRRRKADKTFVAPKLEAYERLLKSSGERSYSTTMAFVQSLNITLRDKEL
FT                   GPHIVPIVADEARTFGMEGLFRQIGIYAPFGQKYKPVDADQLMFYREDQSGQVLQQGIS
FT                   EPGAISSWMAAGTSYSVSNVPMLPFYIYYSMFGFQRVGDIAWQAADMRTRGFLLGGTAG
FT                   RTTLNGEGLQHEDGFSHLVAGGIPNVRSYDPTFGFEVTVVLQHGTKRMMEDQVDEYYYV
FT                   TLMNENYTHPEMPEGAAEGIVKGMYLLTDAGKPKKGELRVQLLGSGTILREAIAAAELL
FT                   DKDFGVTADIWSCPSFNELRRDGFDVERANRLHPEGEQRKAYVTELLEGRQGPAIAATD
FT                   YVRAYADQIRAFVPMSYTVLGTDGFGRSDTRANLRRFFEVDRYYIAHAAIAALAKEGKM
FT                   TAKDVARAIKQYKIDPEKANPVGV"
     MNWLNEVLNN DPNPVETQEW IESLKAVIDV EGSERAHQLL EGMVELTRRS GAYLPFSPTT        60
     EYVNTIEPQL EAKSPGNAEL EWRIRSIIRW NAMATVVRAN RKPGDLGGHI ASFASGATLY       120
     DVGFNHFWRA PSENHPGDLL FIQGHSAPGI YARSFLEGRI SEEQLDKFRM EVDGGGLSSY       180
     PHPWLMPEYW QTPTVSMGLG PLAAIYQAQF MRYLENRGLI EKSDRKVWCF IGDGESDEPE       240
     TLGAIALAGR EGLDNLIFVV NCNLQRLDGP VRGNGKIIQE LEGVFRGGGW NVIKLLWGGY       300
     WDALLAKDSD GVLKKLMMET VDGEYQNCKA FGGAYTREHF FGKYPETAAM VAGLSDDDIW       360
     RLNRGGHDPH KVYAAYHQAV NTKGMPTVIL AKTVKGYGMG SAGEALNPTH QTKKLDDEAV       420
     RHFRDRFNIP VTDAQLADGQ VPFYHPGPDS PEVQYLQERR AALGGYLPQR RRKADKTFVA       480
     PKLEAYERLL KSSGERSYST TMAFVQSLNI TLRDKELGPH IVPIVADEAR TFGMEGLFRQ       540
     IGIYAPFGQK YKPVDADQLM FYREDQSGQV LQQGISEPGA ISSWMAAGTS YSVSNVPMLP       600
     FYIYYSMFGF QRVGDIAWQA ADMRTRGFLL GGTAGRTTLN GEGLQHEDGF SHLVAGGIPN       660
     VRSYDPTFGF EVTVVLQHGT KRMMEDQVDE YYYVTLMNEN YTHPEMPEGA AEGIVKGMYL       720
     LTDAGKPKKG ELRVQLLGSG TILREAIAAA ELLDKDFGVT ADIWSCPSFN ELRRDGFDVE       780
     RANRLHPEGE QRKAYVTELL EGRQGPAIAA TDYVRAYADQ IRAFVPMSYT VLGTDGFGRS       840
     DTRANLRRFF EVDRYYIAHA AIAALAKEGK MTAKDVARAI KQYKIDPEKA NPVGV            895
//

If you have problems or comments...

PBIL Back to PBIL home page