(data stored in ACNUC7421 zone)

EMBL: CP001111.PE369

CP001111.PE369       Location/Qualifiers
FT   CDS             complement(441159..441806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0369"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_1721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50074"
FT                   /db_xref="InterPro:IPR041229"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN1"
FT                   /protein_id="ACF50074.1"
FT                   /translation="MDSTALKEVHRQIRDAQPDSTRVRLHRAISWLNRAEQEDEDTDAR
FT                   FLFLWIALNAAYAQEFGFENAEREQLRRFFDALLRHDKQGSLQDILFKQFPGPIRTLIG
FT                   NRFVYARFWKALREHDSSDQWAERFAKDQRSALQAVVERRTEVVLSIVLDRLYVLRNQL
FT                   VHGGATWDSHANREQLRDGAAILGQLVPAILHLMMRDDAPDLGEVAYPMIPI"
     MDSTALKEVH RQIRDAQPDS TRVRLHRAIS WLNRAEQEDE DTDARFLFLW IALNAAYAQE        60
     FGFENAEREQ LRRFFDALLR HDKQGSLQDI LFKQFPGPIR TLIGNRFVYA RFWKALREHD       120
     SSDQWAERFA KDQRSALQAV VERRTEVVLS IVLDRLYVLR NQLVHGGATW DSHANREQLR       180
     DGAAILGQLV PAILHLMMRD DAPDLGEVAY PMIPI                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page