(data stored in ACNUC7421 zone)

EMBL: CP001111.PE371

CP001111.PE371       Location/Qualifiers
FT   CDS             442710..443714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0371"
FT                   /product="transcriptional regulator-like protein"
FT                   /note="KEGG: hha:Hhal_1283 transcriptional regulator-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50076"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN3"
FT                   /protein_id="ACF50076.1"
FT                   /translation="MDTDNRSSLARQWRLLQLLQPAPHYRTVKELAQTLAAESYKGGTR
FT                   TIERDLNALSLQFPIESNDLQKPYGWAWMRGAAAFSMPGMSVSQAVVLLTAQRNLQGLL
FT                   PANHWPALTPFFDQAEKTLAAVRTTRSTRRWHEKVAVVPASQSLLPAAVDTDVAVNVHQ
FT                   ALFNEKQLRLYYVARGRSDASEYVFHPYGMIQRGTSSYLAGRIDGRTETTTLSLHRVQR
FT                   AEMLDADTEGAESFELGNYASRVAAGFESKGPLSVELELDEALAQHLAETPLSRDQKLD
FT                   VGDGLVPRLRATVDDSAQLRWWLLGLGASVRVLAPAALADDIAARHRSAAQRY"
     MDTDNRSSLA RQWRLLQLLQ PAPHYRTVKE LAQTLAAESY KGGTRTIERD LNALSLQFPI        60
     ESNDLQKPYG WAWMRGAAAF SMPGMSVSQA VVLLTAQRNL QGLLPANHWP ALTPFFDQAE       120
     KTLAAVRTTR STRRWHEKVA VVPASQSLLP AAVDTDVAVN VHQALFNEKQ LRLYYVARGR       180
     SDASEYVFHP YGMIQRGTSS YLAGRIDGRT ETTTLSLHRV QRAEMLDADT EGAESFELGN       240
     YASRVAAGFE SKGPLSVELE LDEALAQHLA ETPLSRDQKL DVGDGLVPRL RATVDDSAQL       300
     RWWLLGLGAS VRVLAPAALA DDIAARHRSA AQRY                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page