(data stored in ACNUC7421 zone)

EMBL: CP001111.PE372

CP001111.PE372       Location/Qualifiers
FT   CDS             443803..445566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_6053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50077"
FT                   /db_xref="GOA:B4SHN4"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN4"
FT                   /protein_id="ACF50077.1"
FT                   /translation="MFAVKNQCLGLLDRITTLADSAAIELPENHSLAEEMQRAELLVPI
FT                   IGAFSAGKSSLINTFLGADILPVGITPETELATELRFSRDPHVLAHRADGGSDRLAVED
FT                   LLSIKPRASSYTHLELHLDDPRLEALYPQVLVDMPGFGSSLDSHNKAIAHYLPRGAHFI
FT                   VAVSVPDGTLAESTLRQLETMHTYEAGFSILLSKANLRSAEEVDAVEVAVREQLELRLG
FT                   VAPAMARDDRKQGNGLASLLPKISASDLWIGRFLPRISSQLAHARAQVKMARKALDQSD
FT                   ADIDRSVRQLNDALDDLNAQRDALVAKLGRSRLSQVVEQCVEEVGQALREASSELQAAA
FT                   AGGNNPRFAQVVSDISRQRLSRVVKERMEGLSQQAIGDLAKSLSQREVDEVGSVGGPDW
FT                   TQQMQTRVQETLTQTGQALERWQGNLQKAREDEKLLRPYAGDDENDREKTQRARVAFRS
FT                   ITTVLAVTTSVVAPAIELVVIFLPEILGFVSRKLREEELRKTIDNQVIPSVQREFRTKL
FT                   PELLQAQVDGLIEQAVHEFKTAIEEKRQLLESVVAEQSSPARAARVKALDAAEAGLTSV
FT                   ANEVVALESAR"
     MFAVKNQCLG LLDRITTLAD SAAIELPENH SLAEEMQRAE LLVPIIGAFS AGKSSLINTF        60
     LGADILPVGI TPETELATEL RFSRDPHVLA HRADGGSDRL AVEDLLSIKP RASSYTHLEL       120
     HLDDPRLEAL YPQVLVDMPG FGSSLDSHNK AIAHYLPRGA HFIVAVSVPD GTLAESTLRQ       180
     LETMHTYEAG FSILLSKANL RSAEEVDAVE VAVREQLELR LGVAPAMARD DRKQGNGLAS       240
     LLPKISASDL WIGRFLPRIS SQLAHARAQV KMARKALDQS DADIDRSVRQ LNDALDDLNA       300
     QRDALVAKLG RSRLSQVVEQ CVEEVGQALR EASSELQAAA AGGNNPRFAQ VVSDISRQRL       360
     SRVVKERMEG LSQQAIGDLA KSLSQREVDE VGSVGGPDWT QQMQTRVQET LTQTGQALER       420
     WQGNLQKARE DEKLLRPYAG DDENDREKTQ RARVAFRSIT TVLAVTTSVV APAIELVVIF       480
     LPEILGFVSR KLREEELRKT IDNQVIPSVQ REFRTKLPEL LQAQVDGLIE QAVHEFKTAI       540
     EEKRQLLESV VAEQSSPARA ARVKALDAAE AGLTSVANEV VALESAR                     587
//

If you have problems or comments...

PBIL Back to PBIL home page