(data stored in ACNUC7421 zone)

EMBL: CP001111.PE374

CP001111.PE374       Location/Qualifiers
FT   CDS             447773..449638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_6055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50079"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN6"
FT                   /protein_id="ACF50079.1"
FT                   /translation="MSGDNGRPLFEGTSAQHLTYLAGWKPWGRRLHVTAIQEQMDAASQ
FT                   RWISIVEDHRRLNITAEQRALALAEREAELKHASGALAERETELERASEALAERGTELK
FT                   NVSEALAESETTRSRERDDAQTREQALAGELDAQRQASQELQKELQEAGRRELDLSQRY
FT                   GAEKMARAQLTTSLVDAQDRLKVQSMQHAATQAALESEQEQSRQLGGDLDLLQAEHAAT
FT                   QIRFALVSRLLAVPPPRNEGIEAFQKLLDDDYMRFASAEASLADEAKALRLLQSIQQEL
FT                   HLMAANPDIFRRTVVGVVGGFSSGKSAFINSFLGKDFKLLSSVTPATVIPSYVYPAQQT
FT                   KIQAYSFNGGCIDLDAGFYQEMSRAFVEKFSFDLKRIMPLVSVGTSMDTERTGNICLMD
FT                   TPGYNPGTEGSFSQSDRAVAVSHSRKSDVLFWVIGIDANGTTPDSDIEFLKEIGFEGRP
FT                   VYVVLNKADLRSADQIEEILGQIEDEIELNGITVEGISVYSSKYGKEYEFRGKSMQDFL
FT                   RERPKGRLPMEHVEDRINEVFELYRSAITESIATAKACRSAARALALDLMQGDVQDAAT
FT                   MRSATQNVETINAAMNLDALSRLLVDADQINAAFLDAARRVLTPA"
     MSGDNGRPLF EGTSAQHLTY LAGWKPWGRR LHVTAIQEQM DAASQRWISI VEDHRRLNIT        60
     AEQRALALAE REAELKHASG ALAERETELE RASEALAERG TELKNVSEAL AESETTRSRE       120
     RDDAQTREQA LAGELDAQRQ ASQELQKELQ EAGRRELDLS QRYGAEKMAR AQLTTSLVDA       180
     QDRLKVQSMQ HAATQAALES EQEQSRQLGG DLDLLQAEHA ATQIRFALVS RLLAVPPPRN       240
     EGIEAFQKLL DDDYMRFASA EASLADEAKA LRLLQSIQQE LHLMAANPDI FRRTVVGVVG       300
     GFSSGKSAFI NSFLGKDFKL LSSVTPATVI PSYVYPAQQT KIQAYSFNGG CIDLDAGFYQ       360
     EMSRAFVEKF SFDLKRIMPL VSVGTSMDTE RTGNICLMDT PGYNPGTEGS FSQSDRAVAV       420
     SHSRKSDVLF WVIGIDANGT TPDSDIEFLK EIGFEGRPVY VVLNKADLRS ADQIEEILGQ       480
     IEDEIELNGI TVEGISVYSS KYGKEYEFRG KSMQDFLRER PKGRLPMEHV EDRINEVFEL       540
     YRSAITESIA TAKACRSAAR ALALDLMQGD VQDAATMRSA TQNVETINAA MNLDALSRLL       600
     VDADQINAAF LDAARRVLTP A                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page