(data stored in ACNUC7421 zone)

EMBL: CP001111.PE376

CP001111.PE376       Location/Qualifiers
FT   CDS             451356..453194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A0848 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50081"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHN8"
FT                   /protein_id="ACF50081.1"
FT                   /translation="MIHPSARSTLTEALQPPSGYRFDAGVATTYSLSLGALLGLPAHFA
FT                   LLGDHDNSAEEDPLRLVEGLRRASRRLAVFCERGRMEAPPAGNALAVLAEGMVHEVCAP
FT                   HGGAFHPKIWALRYVAIDAAAEPATVVRLLVLTRNLTWDRCWDVSLRLDGVPGKAKEAS
FT                   NKPLADFLRWLPLNTEGASPDLERQAMIVSLAKDIERADWEKPPGFTQLAFHVLGTAKR
FT                   AVPWSPLEGGGKAQDVLIVSPFVRAGALQTLREHCNGDFMLVSRADELDRLPAGACLAD
FT                   DSAYVLKPDTLLSEGEEAGQADTLQGLHAKVAVFQRGQRVHVAVGSANYTNAVVQNGSN
FT                   VEVVAELSGPVSRIPAPRQWLDEHLQPLLDTYTPGGGEDAEGAERRQLQDQLEAIRRQI
FT                   AAAAWTLHCETHPVSGWNLALSCPGLPLDGATLHAWPLAVVSERARPVQAGQVDLGTFA
FT                   GHEVSSLVGFQVTPNSTRAEELAVPPLRFALEVSLEGAPDDRADALVAQLLGNRAAFLR
FT                   YLALLLDDPQAAGCGARNRSEGSGGGSRDASGLMANYPLFEQLLRIYSREPERLEAIDR
FT                   MVKRLKDKQFDGQPCLPDDFLALWEVVGNAIGKEAA"
     MIHPSARSTL TEALQPPSGY RFDAGVATTY SLSLGALLGL PAHFALLGDH DNSAEEDPLR        60
     LVEGLRRASR RLAVFCERGR MEAPPAGNAL AVLAEGMVHE VCAPHGGAFH PKIWALRYVA       120
     IDAAAEPATV VRLLVLTRNL TWDRCWDVSL RLDGVPGKAK EASNKPLADF LRWLPLNTEG       180
     ASPDLERQAM IVSLAKDIER ADWEKPPGFT QLAFHVLGTA KRAVPWSPLE GGGKAQDVLI       240
     VSPFVRAGAL QTLREHCNGD FMLVSRADEL DRLPAGACLA DDSAYVLKPD TLLSEGEEAG       300
     QADTLQGLHA KVAVFQRGQR VHVAVGSANY TNAVVQNGSN VEVVAELSGP VSRIPAPRQW       360
     LDEHLQPLLD TYTPGGGEDA EGAERRQLQD QLEAIRRQIA AAAWTLHCET HPVSGWNLAL       420
     SCPGLPLDGA TLHAWPLAVV SERARPVQAG QVDLGTFAGH EVSSLVGFQV TPNSTRAEEL       480
     AVPPLRFALE VSLEGAPDDR ADALVAQLLG NRAAFLRYLA LLLDDPQAAG CGARNRSEGS       540
     GGGSRDASGL MANYPLFEQL LRIYSREPER LEAIDRMVKR LKDKQFDGQP CLPDDFLALW       600
     EVVGNAIGKE AA                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page