(data stored in ACNUC7421 zone)

EMBL: CP001111.PE381

CP001111.PE381       Location/Qualifiers
FT   CDS             459952..461097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spe:Spro_0979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50086"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP3"
FT                   /protein_id="ACF50086.1"
FT                   /translation="MFRNPLFRSAALAVAVSLSLGVPSAFADNAPTASATAAVQRQAVA
FT                   KGLYELAYSPKQNAVFVASSGGFGDDAGPAQVLRLNPTTLAVETRIPLERKAFGVVLDD
FT                   TQNRLYVGNTVDLSVTVVDTAQNKAVGTIQLMEKKTGKDGKAAYTHDLRELVVDSAANR
FT                   LYLTGHSSQPDVSSVLFVIDTTTLKVVNTIDGLGYAKAPGLALDAANKRVYTSNLLADL
FT                   VVVGTDSNKVVAQHKIAAEQPMNIALDPAGKRLFVTDQGSEFLRGYQTKSSGLVSKHPG
FT                   QRVLVLDRSTGKELASIPTDAGPLGILLDAPRKRLYVTNREAGTVTAYNSDSYQKVATY
FT                   TVPTHPNSLALDAKNNVLFVSIKNGEKDDKGADESVARIQL"
     MFRNPLFRSA ALAVAVSLSL GVPSAFADNA PTASATAAVQ RQAVAKGLYE LAYSPKQNAV        60
     FVASSGGFGD DAGPAQVLRL NPTTLAVETR IPLERKAFGV VLDDTQNRLY VGNTVDLSVT       120
     VVDTAQNKAV GTIQLMEKKT GKDGKAAYTH DLRELVVDSA ANRLYLTGHS SQPDVSSVLF       180
     VIDTTTLKVV NTIDGLGYAK APGLALDAAN KRVYTSNLLA DLVVVGTDSN KVVAQHKIAA       240
     EQPMNIALDP AGKRLFVTDQ GSEFLRGYQT KSSGLVSKHP GQRVLVLDRS TGKELASIPT       300
     DAGPLGILLD APRKRLYVTN REAGTVTAYN SDSYQKVATY TVPTHPNSLA LDAKNNVLFV       360
     SIKNGEKDDK GADESVARIQ L                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page