(data stored in ACNUC7421 zone)

EMBL: CP001111.PE382

CP001111.PE382       Location/Qualifiers
FT   CDS             461241..461816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcv:XCV1271 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50087"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP4"
FT                   /protein_id="ACF50087.1"
FT                   /translation="MMGIHRWLRAGLIFTLAGALGACNSRIPDAPEPLDLVKPIIVAEP
FT                   GQAVRFEFETNARNFHPGRTYALELEVEHQGPEDTREPSIATMQIPFEVSLQRLTAGTW
FT                   QDVATYDSYQAMARNAGEALPEWHASSEWRYTSPHMGSDGQYTLSLVALPMEINSRYRV
FT                   DVRTVQRTAALQDYSARLRIHAARPAGK"
     MMGIHRWLRA GLIFTLAGAL GACNSRIPDA PEPLDLVKPI IVAEPGQAVR FEFETNARNF        60
     HPGRTYALEL EVEHQGPEDT REPSIATMQI PFEVSLQRLT AGTWQDVATY DSYQAMARNA       120
     GEALPEWHAS SEWRYTSPHM GSDGQYTLSL VALPMEINSR YRVDVRTVQR TAALQDYSAR       180
     LRIHAARPAG K                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page