(data stored in ACNUC7421 zone)

EMBL: CP001111.PE383

CP001111.PE383       Location/Qualifiers
FT   CDS             461894..462469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0383"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcv:XCV1271 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50088"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP5"
FT                   /protein_id="ACF50088.1"
FT                   /translation="MLGIHRWLLAGLIFTLAGALGACNSRIPDAPEPLDRVKPIDVAEP
FT                   GQEVRFEFETNARNFHPGRPYVLDLEVQRHGPAPDSEPDMDSLHVPFQLYLQRWVAGAW
FT                   QDVATSDVHQATTSNLGEPLPEWHASAGWRYAQQVSMDASRYRLSIVTLPMEMGARYRL
FT                   EVRTVQPTAALQHYPAQLRVHADPLSGK"
     MLGIHRWLLA GLIFTLAGAL GACNSRIPDA PEPLDRVKPI DVAEPGQEVR FEFETNARNF        60
     HPGRPYVLDL EVQRHGPAPD SEPDMDSLHV PFQLYLQRWV AGAWQDVATS DVHQATTSNL       120
     GEPLPEWHAS AGWRYAQQVS MDASRYRLSI VTLPMEMGAR YRLEVRTVQP TAALQHYPAQ       180
     LRVHADPLSG K                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page